KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12348
Entry
Dmel_CG12348      CDS       T00030                                 

Gene name
Sh
Definition
(RefSeq) shaker, isoform E
  KO
K04874  potassium voltage-gated channel Shaker-related subfamily A member 1
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dme04040]
    Dmel_CG12348 (Sh)
Ion channels [BR:dme04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   Dmel_CG12348 (Sh)
SSDB
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 DUF2722 PKD_channel TFIIA
Other DBs
NCBI-GeneID: 32780
NCBI-ProteinID: NP_728123
FlyBase: FBgn0003380
UniProt: P08510
Structure
PDB: 
1HO7 1HO2

Position
X
AA seq 655 aa
MAAVAGLYGLGEDRQHRKKQQQQQQHQKEQLEQKEEQKKIAERKLQLREQQLQRNSLDGY
GSLPKLSSQDEEGGAGHGFGGGPQHFEPIPHDHDFCERVVINVSGLRFETQLRTLNQFPD
TLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFY
ELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLS
IVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLA
CPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAI
LRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAG
SENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSN
FNYFYHRETDQEEMQSQNFNHVTSCPYLPGTLGQHMKKSSLSESSSDMMDLDDGVESTPG
LTETHPGRSAVAPFLGAQQQQQQPVASSLSMSIDKQLQHPLQQLTQTQLYQQQQQQQQQQ
QNGFKQQQQQTQQQLQQQQSHTINASAAAATSGSGSSGLTMRHNNALAVSIETDV
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggccgccgttgccggcctctatggccttggggaggatcgccagcaccgcaagaagcag
cagcaacagcagcagcaccagaaggagcagctcgagcagaaggaggagcaaaagaagatc
gccgagcggaagctgcagctgcgggagcagcagctccagcgcaactccctcgatggttac
gggtctttgcccaaattgagcagtcaagacgaagaagggggggctggtcatggctttggt
ggcggaccgcaacactttgaacccattcctcacgatcatgatttctgcgaaagagtcgtt
ataaatgtaagcggattaaggtttgagacacaactacgtacgttaaatcaattcccggac
acgctgcttggggatccagctcggagattacggtactttgacccgcttagaaatgaatat
ttttttgaccgtagtcgaccgagcttcgatgcgattttatactattatcagagtggtggc
cgactacggagaccggtcaatgtccctttagacgtatttagtgaagaaataaaattttat
gaattaggtgatcaagcaattaataaattcagagaggatgaaggctttattaaagaggaa
gaaagaccattaccggataatgagaaacagagaaaagtctggctgctcttcgagtatcca
gaaagttcgcaagccgccagagttgtagccataattagtgtatttgttatattgctatca
attgttatattttgtctagaaacattacccgaatttaagcattacaaggtgttcaataca
acaacaaatggcacaaaaatcgaggaagacgaggtgcctgacatcacagatcctttcttc
cttatagaaacgttatgtattatttggtttacatttgaactaactgtcaggttcctcgca
tgtccgaacaaattaaatttctgcagggatgtcatgaatgttatcgacataatcgccatc
attccgtactttataacactagcgactgtcgttgccgaagaggaggatacgttaaatctt
ccaaaagcgccagtcagtccacaggacaagtcatcgaatcaggctatgtccttggcaata
ttacgagtgatacgattagttcgagtatttcgaatatttaagttatctaggcattcgaag
ggtttacaaatattaggacgaactctgaaagcctcaatgcgggaattaggtttacttata
tttttcttatttataggcgtcgtactcttctcatcggcggtttattttgcggaagctgga
agcgaaaattccttcttcaagtccatacccgatgcattttggtgggcggtcgttaccatg
accaccgttggatatggtgacatgacacccgtcggcgtttggggcaagattgtgggatca
ctttgtgccattgctggcgtgctgaccatcgcactgccggtgccggtcatcgtcagcaat
ttcaactacttctatcaccgcgaaacggatcaggaggagatgcagagccagaactttaat
cacgttactagttgtccatatttgccaggtacattaggtcaacacatgaagaaatcatca
ttgtctgagtcctcatcggatatgatggatttggacgatggtgtcgagtccacgccggga
ttgacagaaacacatcctggacgcagtgcggtggctccatttttgggagcccagcagcag
cagcaacaaccggtagcatcctcactgtcgatgtcgatcgacaaacaactgcagcaccca
ctgcagcagctgacgcagacgcaactgtaccaacagcagcaacagcagcagcagcagcag
caaaacggcttcaagcagcagcagcaacagacgcagcagcagctgcaacagcaacagtcc
cacacaataaacgcaagtgcagcagcggcgacgagcggcagcggcagtagcggtctcacc
atgaggcacaataatgccctggccgttagtatcgagaccgacgtttga

DBGET integrated database retrieval system