KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12350
Entry
Dmel_CG12350      CDS       T00030                                 
Name
(RefSeq) lambdaTry
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dmel_CG12350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG12350
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG12350
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dmel_CG12350
Peptidases and inhibitors [BR:dme01002]
 Serine peptidases
  Family S1: chymotrypsin family
   Dmel_CG12350
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG12350
SSDB
Motif
Pfam: Trypsin
Other DBs
NCBI-GeneID: 36214
NCBI-ProteinID: NP_610673
FlyBase: FBgn0043470
UniProt: Q7JPN9
Position
2R
AA seq 272 aa
MSRILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHR
CGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTL
NNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSV
NVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCARE
KYPGVYCSVPDVLDWLVETVADKESVGKIDFL
NT seq 819 nt   +upstreamnt  +downstreamnt
atgtcacggattttggttgtgtttctggtgctcggagtgggctgctccctggcagatcct
atataccggaacgaagaggttcatataccgaagctcgatggacgcattgtcggtggacag
gacacgaacatcacccaatatccgcatcagatctcgatgaggtatagaggaaatcaccga
tgcggaggcacaatttacagatcaaaccagatcatcagtgctgcccattgtgtaaacacc
ttgtccggcccggaaaaccttaccattgtggctggttcctcgaacatctggttccccacg
ggtccgcagcaggagttggaagtccgtgagatcatcattcatcccaagtatcgcactctg
aacaacgactacgatgcggcaattctgatcctggatggggatttcgagttcaacgacgcc
gtgcagccgattgagttggccaaggagcggcccgatcatgatacacccgttaccgtgacg
ggctggggaaccaccagcgaaggcggaaccatctccgacgtcctgcaggaggtcagcgtt
aatgtggtggacaactcgaactgcaagaacgcctattccattatgctgaccagtcgtatg
ctttgcgccggagtcaacggaggtggaaaggatgcatgccagggagattccggtggtccg
ctggtctacaacaacacactcctgggcattgtgtcctggggaacgggctgtgcccgtgag
aaatatcccggagtctattgctccgtaccggatgttctcgattggctggtggagaccgtt
gcggataaagagagtgtgggcaaaatcgactttctgtaa

DBGET integrated database retrieval system