KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1236Help
Entry
Dmel_CG1236       CDS       T00030                                 

Gene name
CG1236
Definition
(RefSeq) uncharacterized protein
  KO
K00049  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00260  Glycine, serine and threonine metabolism
dme00620  Pyruvate metabolism
dme00630  Glyoxylate and dicarboxylate metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dmel_CG1236 (CG1236)
   00630 Glyoxylate and dicarboxylate metabolism
    Dmel_CG1236 (CG1236)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dmel_CG1236 (CG1236)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     Dmel_CG1236 (CG1236)
    1.1.1.81  hydroxypyruvate reductase
     Dmel_CG1236 (CG1236)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored Shikimate_DH Sacchrp_dh_NADP NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 40708
NCBI-ProteinID: NP_649579
FlyBase: FBgn0037370
UniProt: Q8I725
Position
3R
AA seq 347 aa AA seqDB search
MPPRLPFGQVRNLLIQGHIIRRMSSQHKVYVTRPDVDDSGLELLRKSCQVSTWHETNPVP
RSELIRVVAGKDALYCALTDKVDKEVLDAAGPQLKCVATISVGYDHIDVEECRKRGIRVG
FTPDVLTDATAELTLALLLATNRRLFEANKQVYNGGWKSWAPMWMCGQGLKGSRVGLLGF
GRIGQEIAARIVPFKPTEITYTTRSLRPKEAAAVNARHVDFDEMLRESDLIVVCCALTPE
TKEIFNATAFQKMKPNCILINTARGGVVDQKALYEALKTKRILAAGLDVTTPEPLPIDDP
LLKLDNVVILPHIGSADIETRKEMSRITARNILAALAGDKMVAEVEL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgcggttgccgttcggacaagtcagaaacttattgattcagggacacataatt
cgaaggatgagctcccaacacaaggtgtacgtaaccaggccggatgtggatgacagcggt
ctggagctgctgcgcaagagctgccaagtgagtacctggcatgagaccaatccggtgccc
cgctccgagcttatccgcgtcgtggccggaaaagatgccctttactgcgctctaacggac
aaggttgacaaggaagtcttggatgctgccggtcctcagttgaagtgcgtggcaactatt
tcggtgggttacgatcacatcgacgtggaggagtgcaggaaacgtggaattcgagtgggc
ttcacaccggacgtcctaacggatgccacggcagaattaacgcttgccctgcttctggcc
accaaccgccgactattcgaggccaacaagcaggtttacaacggcggctggaagtcgtgg
gcccccatgtggatgtgcggccagggactgaagggctcccgggtcggcctgctgggcttc
ggccgcatcggccaagagatagcggcacgcattgtgccatttaagccgacggagataaca
tacacaacacgatcactgcgccccaaggaggcggctgctgtgaatgcccggcacgtggac
tttgacgagatgcttcgcgagtcggacttaatcgtagtctgttgcgccctaaccccggag
actaaggaaatcttcaatgccactgcctttcagaagatgaagcccaactgcattcttatc
aacacggcgcgtggtggcgttgtagaccagaaggccctgtacgaggcactgaaaaccaaa
cgaattctagcagctggtctggatgtaacgacgccggagccattgccaatcgacgatcct
cttctgaaactggataatgtggttattctcccccacattggcagcgctgacatcgaaacg
cgcaaggaaatgtcccggattacagccagaaatattcttgctgccttagctggcgataaa
atggtagccgaagtagagctgtaa

DBGET integrated database retrieval system