KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12398
Entry
Dmel_CG12398      CDS       T00030                                 
Symbol
CG12398
Name
(RefSeq) uncharacterized protein
  KO
K00115  glucose 1-dehydrogenase (FAD, quinone) [EC:1.1.5.9]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00030  Pentose phosphate pathway
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dmel_CG12398 (CG12398)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.9  glucose 1-dehydrogenase (FAD, quinone)
     Dmel_CG12398 (CG12398)
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C Lycopene_cycl DAO FAD_binding_2 NAD_binding_8 Pyr_redox_2 Thi4 HI0933_like
Other DBs
NCBI-GeneID: 32422
NCBI-ProteinID: NP_572985
FlyBase: FBgn0030596
UniProt: Q9VY02
Position
X:complement(14911781..14913812)
AA seq 633 aa
MSAINTFVAMWRFLLTLGPSAMIILLLNKGILEQRPDIVDEQHRVRSIHIEDLRESYDFI
VIGGGSAGCVLAARLSENPEWSVLLLEAGGDEPLLIDLPQLYPVFQRSPWDWKYLTEPSD
RYCLAMEDQRCFWPRAKVLGGCSSINAMMYIRGNRRDYDQWAALGNPGWNYDNILHYFRK
LEDMRVPGFEHSPYHGHGGPISVERYRFPSPLLDIFMRAAQQLGMVHPDGDFNGRSQTGF
APPHGSLRDGLRCSANKGYIRRSWQRPNLDIVLKAFVERIVIDPQSHRAIGVIFEYGLLK
HTVRAKREVILSAGSLASPQLLMVSGVGPRDQLEPQGIPVVQHLPGVGGNLQDHISTSGA
IYTFDSGQNRHLSFIVPEMMNEQAVEDFVQGSDSFFYAMPVSEVMGFFSTRYQDPRLDWP
DVQIFMGSYGYGADGGMIGRRGAAITLDNYAEAFEPVLYQDSFVIAPLLMRPRSRGYLQL
RSADPKVHPLIHANYYDDPHDMAVMVEGLKLAHRLTQTPVMQSLNATMNIYEWRNCPEVE
YLSDAFWECLARFYSQTIYHPVGTCKMAPASDPAGVVDPRLRVRGMRGLRVIDASIMPTI
PTGNTNAPTLMLAERGADIIKEDWRHYRDGGWG
NT seq 1902 nt   +upstreamnt  +downstreamnt
atgtcggcgatcaacacgtttgtggccatgtggcggtttctgctgacccttggtccctcg
gccatgatcattctgctactgaacaagggaatcctagagcaacggccggatattgtggat
gagcagcatcgcgtacgctccatacatatcgaagatcttcgtgaatcttacgattttata
gtcattggcggcggatcggcgggttgtgttttagccgccagactctcggagaatccggaa
tggagcgtactacttttggaagccggtggggatgagcctcttctcatcgatttgccgcaa
ttgtatccggtattccagcgaagcccgtgggactggaagtatcttaccgaaccatcggat
cgctactgcttggccatggaggatcaacgctgcttttggccaagggccaaagttttggga
ggatgcagttccatcaacgcgatgatgtatatacgtggaaatagacgggactacgatcaa
tgggcggcattgggaaatcccggctggaattatgacaatattctgcactatttccgcaag
ttggaggacatgagggtgcctggattcgaacatagtccgtatcatggacatggaggtccc
atttccgttgaaagatatagatttccttcgccacttttggatattttcatgagagctgcc
caacagctgggcatggttcatcccgatggtgatttcaatggtcgatctcagacaggattc
gctccaccgcatggaagccttcgcgatggattgcgctgtagtgccaacaaaggatatatt
cgacgcagttggcagcgtcctaatttggatatcgtcctgaaagcatttgtcgagcgaatt
gtgatcgatccgcaatcccatcgagcaattggagtgatctttgaatatggtctgctgaag
cacacggtcagagccaaacgagaggtgattctgtccgcaggatccttggctagtccacag
ctgctgatggtcagcggtgtgggccctagggatcaactggaaccacaaggcattccggtg
gtccagcatttaccgggagtgggtggcaatctgcaggatcacatctccacctcgggtgca
atctatacgtttgacagtggacaaaatcgccatctgtcgtttattgtgcccgaaatgatg
aatgaacaggcggttgaggatttcgttcaaggatcagatagcttcttctacgccatgcca
gtgagtgaggtgatgggctttttcagcactcgttatcaggatccccgattggattggccc
gatgttcagatctttatgggcagctatggctatggagccgatggtggaatgattggtcgc
agaggagctgccattacattggacaactatgccgaggcgtttgagccggtgctctaccag
gactcgtttgtaatagctccactgctgatgcgaccacgctccagaggatacctacagtta
cgctctgcagatcctaaagttcatcctctaatccatgccaactactatgacgatccgcac
gatatggccgtgatggtggaaggcctgaagttggcccatcgtctaacccaaacgccggtg
atgcaatccctgaatgccactatgaatatctacgagtggcgcaattgcccggaagtggaa
tacctcagcgatgccttctgggagtgcttggccagattttactcgcagacgatctatcat
ccggtgggcacatgcaaaatggctccagcttcggatcccgccggtgtcgtagatccccga
ctgcgggtcagaggaatgcgaggattgcgggtcatcgatgccagtataatgcccactatt
ccaactggaaatacgaatgctccgactctaatgctggcggaaaggggagcggatatcatc
aaggaggactggcgccactatagagatggaggttggggttag

DBGET integrated database retrieval system