KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1242Help
Entry
Dmel_CG1242       CDS       T00030                                 

Gene name
Hsp83
Definition
(RefSeq) heat shock protein 83, isoform B
  KO
K04079  molecular chaperone HtpG
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG1242 (Hsp83)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dme01009]
    Dmel_CG1242 (Hsp83)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dme03110]
    Dmel_CG1242 (Hsp83)
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG1242 (Hsp83)
   03051 Proteasome [BR:dme03051]
    Dmel_CG1242 (Hsp83)
   03029 Mitochondrial biogenesis [BR:dme03029]
    Dmel_CG1242 (Hsp83)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG1242 (Hsp83)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dmel_CG1242 (Hsp83)
Chaperones and folding catalysts [BR:dme03110]
 Heat shock proteins
  HSP90
   Dmel_CG1242 (Hsp83)
Membrane trafficking [BR:dme04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    Dmel_CG1242 (Hsp83)
Proteasome [BR:dme03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    Dmel_CG1242 (Hsp83)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    Dmel_CG1242 (Hsp83)
Exosome [BR:dme04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dmel_CG1242 (Hsp83)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 38389
NCBI-ProteinID: NP_001261362
FlyBase: FBgn0001233
UniProt: P02828 M9PBL3
Position
3L
AA seq 717 aa AA seqDB search
MPEEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDS
GKELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIG
QFGVGFYSAYLVADKVTVTSKNNDDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKE
DQTDYLEESKIKEIVNKHSQFIGYPIKLLVEKEREKEVSDDEADDEKKEGDEKKEMETDE
PKIEDVGEDEDADKKDKDAKKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKS
LTNDWEDHLAVKHFSVEGQLEFRALLFIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCE
DLIPEYLNFMKGVVDSEDLPLNISREMLQQNKVLKVIRKNLVKKTMELIEELTEDKENYK
KFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTSASGDDFCSLADYVSRMKDNQKHVYFIT
GESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEYKGKQLVSVTKEGLELPEDE
SEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCCIVTSQFGWSANMERIMK
AQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLVILLFETSLLSSG
FSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSAGDAPSLVEDTEDASHMEEVD
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagaagcagagacctttgcattccaggctgagattgctcagctgatgtccctg
atcatcaacacattctactcgaacaaggagattttcctgcgcgagttgatctcgaacgct
tccgatgccctggacaagatccgctatgagtcccttactgaccccagcaagctggactct
ggcaaggagctgtacatcaagctgatccctaacaagacggctggtactctgaccatcatt
gataccggtatcggtatgaccaagtccgacctggtcaacaacttgggaaccattgccaag
tccggaaccaaggccttcatggaggctctgcaggctggtgccgacatttccatgatcggt
cagttcggtgtgggtttctactccgcctacctggtcgccgacaaggtgactgtcacctcc
aagaacaacgatgacgagcagtacgtgtgggagtcctctgccggaggctctttcacagtc
cgtgccgacaactctgagcccctgggccgtggcaccaagatcgtgctgtacatcaaggag
gaccagaccgactatctggaggagagcaagatcaaggagattgttaacaagcactcccag
ttcattggctaccccatcaagctgctcgtagagaaggagcgcgagaaggaggtcagcgac
gatgaggctgatgatgagaagaaggaaggtgatgagaagaaggagatggagactgatgag
cccaaaatcgaggatgttggcgaggatgaggatgccgacaagaaggacaaggatgccaag
aagaagaagaccatcaaggagaagtacactgaggatgaggagctgaacaagaccaagccc
atctggacccgcaatcccgatgatatctcccaggaggagtacggcgagttctacaaatcc
ctgaccaacgactgggaggatcatctggccgtcaagcacttctccgtggagggtcagctg
gagttccgtgctctgctcttcattccccgtcgcacgcccttcgatctcttcgagaaccag
aagaagcgcaacaacatcaagctgtacgtgcgtcgtgtcttcatcatggacaactgcgag
gacctcattccagagtacttgaacttcatgaagggtgtggtcgactccgaggatctgccc
ctcaacatctcacgtgagatgctgcagcagaacaaggtcctaaaggtgatccgcaagaac
ctggtcaagaagaccatggagctgattgaggagctcaccgaggacaaggagaactacaag
aagttctatgaccagttcagcaagaacctgaagctgggtgtgcacgaggacagcaacaac
cgtgccaagttggccgacttccttcgcttccacacctctgcctccggcgacgatttctgc
tccctggccgactacgtgtcgcgcatgaaggataaccagaagcacgtgtacttcatcact
ggcgagtccaaggaccaggtcagcaactctgccttcgtggagcgcgtcaaggcccgtggc
ttcgaggtggtctacatgaccgagcccatcgatgagtatgtcatccagcacttgaaggag
tacaagggcaagcagctggtctctgtcaccaaggagggtctggagctgcctgaggatgag
agcgagaagaagaagcgcgaggaggacaaggccaagttcgagagcctgtgcaagctgatg
aagtccatcctggacaacaaggtcgagaaggtggtggtgtccaaccgcctggtggattcg
ccctgctgcattgtcacttcgcagttcggctggtccgctaacatggagcgcatcatgaag
gcccaggctctgcgtgataccgccacaatgggctacatggccggcaagaagcagctggag
atcaaccccgatcacccaattgtggagactctccgccagaaggccgatgccgacaagaac
gataaggccgtcaaggatctggtcatcctgctgttcgagacctctctgctgtcctctgga
ttctcgctggacagcccccaggtgcacgccagccgcatctaccgcatgatcaagctgggc
ttgggaatcgacgaggacgagcctatgactaccgacgatgcccagagcgccggagatgcc
ccctcgctggttgaggacacagaggacgcttcccacatggaggaggtcgattaa

DBGET integrated database retrieval system