KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12559Help
Entry
Dmel_CG12559      CDS       T00030                                 

Gene name
rl
Definition
(RefSeq) rolled, isoform C
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04068  FoxO signaling pathway
dme04140  Autophagy - animal
dme04150  mTOR signaling pathway
dme04214  Apoptosis - fly
dme04320  Dorso-ventral axis formation
dme04350  TGF-beta signaling pathway
dme04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG12559 (rl)
   04350 TGF-beta signaling pathway
    Dmel_CG12559 (rl)
   04068 FoxO signaling pathway
    Dmel_CG12559 (rl)
   04150 mTOR signaling pathway
    Dmel_CG12559 (rl)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG12559 (rl)
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG12559 (rl)
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    Dmel_CG12559 (rl)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dmel_CG12559 (rl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG12559 (rl)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG12559 (rl)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG12559 (rl)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dmel_CG12559 (rl)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Dmel_CG12559 (rl)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     Dmel_CG12559 (rl)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG12559 (rl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase YukC Choline_kinase FTA2 Kinase-like
Motif
Other DBs
NCBI-GeneID: 3354888
NCBI-ProteinID: NP_001015122
FlyBase: FBgn0003256
UniProt: P40417
Position
2R
AA seq 376 aa AA seqDB search
MEEFNSSGSVVNGTGSTEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLT
NQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCL
METDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICD
FGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPI
FPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALAL
DLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLI
FEETLKFKERQPDNAP
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatttaattcgagcggatcagtagttaatggtacaggatctacggaagttcct
caatctaatgctgaagttataaggggacaaatatttgaagttggtcctaggtatattaaa
ctcgcctatataggtgaaggagcttatggcatggttgtgtctgcggatgacacgctaaca
aaccaaagagttgcaataaaaaaaatatcgccctttgaacaccaaacttattgtcaaagg
actctcagagaaataaccatattgaccagatttaaacatgaaaacattattgatattcga
gatattcttcgagttgatagcatagaccaaatgagagatgtttatattgtacagtgtttg
atggagactgatttgtataaactacttaaaacacagaggctaagtaatgatcacatctgt
tacttcttatatcagatattgcgtggactcaagtacattcattccgcaaacgtcttgcat
cgggaccttaagccaagtaatttactgttgaacaagacgtgcgacttaaaaatttgcgac
tttggattggctcgtattgcagatcccgagcacgatcatactggctttctcacagaatac
gttgctacccgatggtatagagcacctgaaataatgcttaactcaaaaggatacaccaaa
tctatagacatatggtccgttggctgcattttggctgaaatgttaagtaatcggccaata
tttcctggaaaacattacctggatcaacttaatcatattcttggagtattgggttcaccg
tcccgggacgatttagagtgtattattaatgaaaaggcacggaactatttggaatcttta
ccatttaagccaaatgtaccctgggcgaaactatttccaaatgctgatgcgttggcttta
gatctccttggaaaaatgttaacatttaacccgcataaacggattcctgtcgaggaagct
cttgcacatccctatttagagcaatattatgatcctggagatgagcctgtcgctgaagtg
ccatttcggattaatatggaaaatgatgacatttctcgagatgccctgaagtcgttgatt
tttgaagaaaccttaaaatttaaggaacgacaaccagacaatgcgccttaa

DBGET integrated database retrieval system