KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12792Help
Entry
Dmel_CG12792      CDS       T00030                                 

Gene name
l(2)09851
Definition
(RefSeq) lethal (2) 09851, isoform B
  KO
K14848  ribosome assembly protein RRB1
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dme03009]
    Dmel_CG12792 (l(2)09851)
Ribosome biogenesis [BR:dme03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    Dmel_CG12792 (l(2)09851)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 CAF1C_H4-bd ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 46662
NCBI-ProteinID: NP_001260713
FlyBase: FBgn0022288
UniProt: Q8SYL1
Position
2R
AA seq 456 aa AA seqDB search
MDDGNENISMEVVEPEDAESDMSSDSGSDAEDDTAEPKAPKEVYLPGTKLADDEELVCDE
SAYVMLHQASTGAPCLSFDVIPDELGSGRQSFPMTAYIVAGTQASRAHVNNLIVMKMSNL
HKTQDNDGDEDEELEDDQDDVTDREELKKPQMTCALVKHQGCVNRVRARRLGNSVYAASW
SELGRVNIWDLTQPLQAVENAQLAKQYEQSEARPVFTFGGHQQEGFAIDWSPSADGVLAT
GDCRRDIHVWTPVEDGTWKVDQRPLAGHSQSVEDLQWSPNERSVLASCSVDKTIRIWDCR
ASPQKACMLTCEDAHQSDVNVISWNRNEPFIASGGDDGYLHIWDLRQFQSKKPIATFKHH
TDHITTVEWSPAEATVLASGGDDDQIALWDLAVEKDIDQAVDPAQNEDVLNKLPPQLLFI
HQGQKEIKELHWHPQLPGVLLSTAHSGFNIFRTISV
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggatgatggaaatgaaaacattagtatggaagtggtggagcccgaagacgccgagagc
gacatgagctctgacagtggtagtgacgcagaagacgataccgctgagcccaaagccccc
aaagaggtctacttgcccggaaccaaactcgcagacgatgaggagctggtctgcgatgag
agtgcgtacgtgatgctgcaccaagcttctacgggagctccctgcctgagctttgatgtc
attcccgacgagttgggcagcggacggcagtcgttcccgatgacggcttatattgtggcc
ggcacgcaagcttcccgcgcccatgtcaacaaccttattgtgatgaaaatgagcaacctg
cacaagacgcaggacaatgacggcgacgaagacgaggagctagaagacgaccaagacgac
gtgactgacagggaggagctcaaaaagccgcagatgacatgcgcccttgtcaagcaccaa
gggtgcgttaatcgcgtccgtgcccgccgattgggcaattcggtctacgctgcctcctgg
agcgaacttggtcgtgtgaacatttgggacctaactcagccattgcaggccgtggagaac
gctcagttggccaagcagtacgagcaaagcgaagcgcgtccagtgtttacttttggtggc
catcagcaggagggcttcgccatcgactggagtcccagtgcagatggtgtactggcgaca
ggggactgccggcgagacatacacgtgtggactccggtagaagacggcacatggaaagtt
gatcaacgtcccctagcgggccactcacagtcagttgaagatctgcaatggagtccaaac
gaacgtagcgttctcgcgtcctgttcggtggacaaaaccatccgaatttgggactgccgc
gcctcgcctcagaaagcatgtatgctgacatgcgaggacgcacaccagagcgacgtaaac
gtgatttcgtggaatcgcaacgagccttttatcgccagtggcggcgacgacggctacctc
cacatctgggacctacgtcagtttcagagcaaaaagccgattgccacttttaagcaccac
acggaccacatcactactgtcgaatggagtcccgcagaggctaccgtactggcgtcaggc
ggtgacgatgaccaaattgctttgtgggatttggctgtagagaaggacatcgatcaggcg
gtggacccggcgcaaaacgaagatgtcctaaacaagttgccaccgcaattgctttttatt
caccagggacaaaaggagattaaagagctacactggcaccctcaactgccgggcgttcta
ctttctacagcccacagtggctttaatatctttcgcacgatcagtgtctga

DBGET integrated database retrieval system