KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12807
Entry
Dmel_CG12807      CDS       T00030                                 

Gene name
Spn85F
Definition
(RefSeq) serpin 85F
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 41221
NCBI-ProteinID: NP_649965
FlyBase: FBgn0037772
UniProt: Q9VH46
Position
3R
AA seq 640 aa
MAGLVLLFTWLLVHLLQVDAHYIQIDHEEFRASGFPHPHFPPPPLTPLDHLPQVLAAKEL
TPAEVMVDLTNDLTHRLLHYHSILNRNNFAFSPTALVSVLVALFEGSAGNTAEELRHVLQ
LPNNRDVTRVGYRDIHRRLRTYFFGSDNPLKGLSLNKGNVTVLKDFETVLMFYGYDLSVD
MLSSTPANLTSDAELVNTTMASNTTTMEMDAETTTSKDAESTTEEPATTTTEPPATTTAE
PPTTTTETPAETEATTEAPAATSGEEEAAEPAGEDEAAELVSAFVAEEDSEPLLRIQKAR
VSRLPTSKLQAPLKHSNPITPKPIYLPSARTVAMPMPMMARQVAERKPPGTRQVISIIAP
SVQPANISVTRKTKTARYKRHAIPAYKDLDANLFLTLFNPHTHVPHHPLHFPPPVPAAFA
PITNDFEPHYIGEAAEGKSNYNTDVISHVFYLGNQQVVHTTFKVYNAVLYYKYFEHLKMS
VLELELDTPEYNLMILLPDYHTDIVAAAASLKLGPTLRLMRKQLKPRWVQAIIPDFKLHG
TMFLTNDLQNMGICDVFEPNRADFRPMTEEKGVYVRHIEQSIDVTIRTHPINQLKRNYGA
QSKPIQISVNHPFLFFIVDRDLDVAVMSGRILNPLNVRIQ
NT seq 1923 nt   +upstreamnt  +downstreamnt
atggctggattggtgctactgttcacctggctgttggtccacctactccaggtggatgcc
cactatatacaaattgaccatgaagaatttcgtgccagcggctttccgcatccgcacttt
ccgccgcctccgctaacgccgctggatcatctacctcaggtgctggccgccaaggagctg
actcccgccgaggtgatggtggacctgaccaacgacctgacccaccgcctgctccactac
cattccatcctgaaccgcaacaacttcgccttctcgcccactgccttggtcagtgtgctg
gtggctctgttcgagggttcggccgggaataccgccgaggaactgcgccatgtcctgcag
ctgcccaacaacagggatgtgacccgcgtgggctaccgcgacatccatcgacgactgcgg
acttacttttttggctccgacaatccactgaaaggactcagcttgaacaagggcaatgtc
actgttctcaaggactttgagacggttcttatgttttacggatatgacttaagtgtagat
atgctctcctccacaccagccaatctcacatcagatgccgagttggtcaacaccacaatg
gccagcaatacgacgaccatggaaatggatgcggaaaccacaacgtcaaaggatgcggag
agcacaacagaagagccggccacaacaaccacagagccgccggcgacgacaacggcagag
ccaccaaccaccaccacagagactccagcggaaacggaggccaccacagaagcacctgct
gcaacatcgggtgaagaggaggccgctgagcccgctggtgaggatgaagcagccgagtta
gtgtccgcttttgtagccgaggaggactccgagcctctcttgcgcatccagaaggctcga
gtctccagattgcccaccagcaaactacaggcgccgctaaagcattcgaatccaatcact
cccaagcccatttacctgcccagtgcgcgaacagtggccatgccaatgccaatgatggct
cgccaggtggcggagcgaaagccaccaggaacacggcaagtaatttctattatagcgcca
tccgtgcaaccagcaaacatatcggtgactcgcaagacgaagacagcacgatacaagcgt
catgcgataccagcatacaaggatctggatgcaaatctctttctgaccctcttcaatccg
cacacgcatgtcccgcaccacccgctgcactttccgccgccagtgcccgctgcctttgca
cccatcacgaatgattttgagccacactatatcggagaggcggccgagggaaagtccaac
tataacacggatgtgatcagccacgtattctacttgggcaatcaacaggtggtgcacacc
accttcaaggtatataacgcagtgctgtactacaagtactttgagcacctgaagatgagc
gtgctggagttggaattggacacaccggagtacaacctaatgatcctgttgcccgactac
cacacggatattgttgcagccgccgcctccttgaaactgggaccaacccttcgactgatg
cggaagcagttgaagccacgctgggtgcaagccatcattccagatttcaagctgcacggc
accatgtttttgacaaacgacttgcagaatatgggaatctgcgacgtattcgaaccaaat
cgcgccgatttcaggcccatgactgaggagaagggcgtctacgtgcgacacattgagcaa
tccatagacgtcaccatccgtacgcatcccatcaatcagctgaagcgcaactacggcgcc
caatcgaagcccattcagatctctgtgaatcatccgtttctgtttttcatcgtcgatcgc
gacttggacgtggctgtgatgtcgggccgcatactgaatccgctgaacgtacgcatccaa
tga

DBGET integrated database retrieval system