KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12952Help
Entry
Dmel_CG12952      CDS       T00030                                 

Gene name
sage
Definition
(RefSeq) salivary gland-expressed bHLH, isoform A
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 41105
NCBI-ProteinID: NP_524287
FlyBase: FBgn0037672
UniProt: Q9VHG3
Position
3R
AA seq 268 aa AA seqDB search
MTDQLLSSTAGVPGDPPPVLVPVSATTGGPYLSGGSEGEAESSEQPVLLELGAPQSSSCP
AVSLNYTLTADGAGLLAYAPTHPHSYSPSVMGGYEKEAHNMGLLPPTYSVIPQPVSMWHA
GQVATGSPVGLECNKPSELVPPPMYMSYSGGSIANSTEVDIAKEHNPAWREKALQMEKDY
RRTACDRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQAMLRESS
VGQNGNGCCAWSGGSSSPYDNGNDHWGA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcaactgctgagctccacggccggcgtaccgggtgatccaccgccagttttg
gtgcccgtatcagccaccaccggtggaccctatttgagcggtggatccgagggcgaggcg
gaatcatcggaacagcccgttcttctagagctcggtgcccctcaatcgtccagttgtccg
gcagttagtctcaactacaccctaaccgcggatggagcaggcttgctggcatatgcgcca
actcatccgcatagctactcacccagcgtgatgggtggctacgagaaggaagcgcacaat
atgggtctgttgccacccacatatagcgttatacctcagccggtgtcgatgtggcatgct
ggccaggtggccaccggttcgccagtgggcttggaatgcaacaaacccagtgagctggta
cctccgcccatgtatatgagctatagcggcggtagtatagccaatagcactgaggtggac
atcgccaaagagcacaatcccgcctggcgggagaaggcgctgcaaatggagaaggactat
agacgcaccgcctgcgatcgggaaagaaccaggatgcgggacatgaaccgagcctttgac
ttactgcgctccaagctacccatatccaagccaaatgggaaaaagtactccaaaatcgag
agtttgaggattgccatcaactacattaatcacctgcaggccatgctgcgggagagctcc
gtgggtcaaaatggcaatggatgctgtgcctggagcggcggaagtagttcaccttatgat
aatggcaacgatcattggggagcgtaa

DBGET integrated database retrieval system