KEGG   Drosophila melanogaster (fruit fly): Dmel_CG13271Help
Entry
Dmel_CG13271      CDS       T00030                                 

Definition
(RefSeq) Ugt36Bb
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00040  Pentose and glucuronate interconversions
dme00053  Ascorbate and aldarate metabolism
dme00830  Retinol metabolism
dme00860  Porphyrin and chlorophyll metabolism
dme00980  Metabolism of xenobiotics by cytochrome P450
dme00982  Drug metabolism - cytochrome P450
dme00983  Drug metabolism - other enzymes
dme01100  Metabolic pathways
Module
dme_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG13271
   00053 Ascorbate and aldarate metabolism
    Dmel_CG13271
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmel_CG13271
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG13271
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG13271
   00982 Drug metabolism - cytochrome P450
    Dmel_CG13271
   00983 Drug metabolism - other enzymes
    Dmel_CG13271
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dmel_CG13271
Glycosyltransferases [BR:dme01003]
 Others
  Hydrophobic molecule
   Dmel_CG13271
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_4_2 Glyco_trans_1_3 Glyco_transf_4 Sigma54_AID
Motif
Other DBs
NCBI-GeneID: 53512
NCBI-ProteinID: NP_652628
FlyBase: FBgn0040261
UniProt: Q9VJH9
Position
2L
AA seq 539 aa AA seqDB search
MIEYTKIGFLIAFLLSTMTQSSGGANILGVFGTHSPSHVIVHMAVMKALADRGHNITVVT
QMKPKLATHENITVIIAPPTEERQRYIKEYMAEVSNEKPSFWETMVKAIVQSSNQLEGQY
EFMTHPNVKEIYENPKIKFDLVFLGLMANTYQLGIAAKLKCPVIISWVGIPLPFMDTIVG
NVNDPSYVPTVNVALNAGQKTMDFGLRFVNFFKYAIMCVFETVLDYKMNQFYERAFANEL
EFPNYHEMKRRVSLLFYNYHSASEGPIRPTVPQSIEIGGIQVKEQADPLPKELAKFLDKA
DEGAIFFSLGTNVNTNTFRPDTVDILYKVLSKLPQRVIWKWEDLKNKPGNASNIFFGNWL
PQDDILAHPNTKLFITHAGKGGVAEAQYHGVPMVALPIFGDQQGNAEIMTKSGFGRWLDI
LTMTEHELEQTIREVLGNPAYRETIGKFSTLYRDRPLTARQSVIYWTEYVLRHQGALHLQ
SPLIHTKFVARNNLDVYGVVLLVSLLLIVTIKFLFRKILNVAIGYGSQRKAVANKLKNN
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgattgaatatactaaaatcggatttttgattgcattccttctgagcacgatgacccaa
agcagtggtggagccaatatattgggagttttcggaacacacagtccttcgcacgtgatc
gtgcatatggctgtgatgaaagcccttgctgatcgaggtcacaacattacagtggtgacc
cagatgaaaccgaaattggcgacacatgaaaatattaccgtgatcattgcaccgccgacg
gaggagagacagagatatatcaaagaatatatggctgaggtatctaatgagaaaccttcg
ttctgggagaccatggtcaaggcgatcgtccaatcttccaatcaactggaaggacaatat
gagtttatgacgcatcccaatgtcaaagagatctacgagaatccaaagatcaaattcgat
ttggtgtttttgggattgatggccaacacctatcagttgggcattgctgccaagttgaaa
tgtccggtcattatatcgtgggtgggcattccgctgcccttcatggacaccattgtgggt
aatgtcaacgatccatcgtatgtcccgaccgtaaatgtagcccttaatgcgggtcaaaag
accatggactttggcctaagatttgtgaacttttttaaatatgccatcatgtgcgttttt
gagacagtattggactataagatgaaccagttttacgagcgagcttttgctaatgaattg
gagtttccaaactatcatgagatgaagcgacgagtttccttgttgttctataattaccat
tccgccagcgaaggacccatcagaccgacagtacctcaatcgattgaaattggcggaata
caagtaaaggagcaggccgatcctctgcccaaggagttggccaagtttcttgataaggct
gatgagggcgcgatatttttcagtctaggaactaatgtgaatacgaatacctttcgaccc
gataccgttgatatcctgtacaaagtgctatccaagttgccacagagagttatttggaag
tgggaggacctgaaaaacaagccaggaaatgcctccaacatattcttcggcaattggctg
ccccaggacgatatcttggcccatccgaatacgaaactattcataacccatgcgggcaag
ggcggtgtggcagaggctcaatatcatggagttcccatggtcgcgctaccgatctttggc
gatcaacagggaaatgctgaaatcatgacaaaatctggctttggccgatggttggatatt
ctcacaatgacggagcatgaactggagcagactatccgtgaggtccttgggaatcccgcg
tatcgtgagacgattggaaagttctccaccctttacagggatcgtccgttaacagcccgt
caatcggtcatctactggaccgagtacgtattgcgtcatcaaggagcccttcacctgcag
agtcccctcattcacacaaaatttgtggctcgaaacaatctcgatgtctatggagtagtt
ctcctggtcagtcttctactcatagtcactattaagtttctatttcgcaagattttaaat
gttgcgattggttacggtagtcagcggaaagcggtggcaaacaagcttaaaaataattaa

DBGET integrated database retrieval system