KEGG   Drosophila melanogaster (fruit fly): Dmel_CG13398
Entry
Dmel_CG13398      CDS       T00030                                 

Gene name
CG13398
Definition
(RefSeq) uncharacterized protein, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: IRS
Other DBs
NCBI-GeneID: 34169
NCBI-ProteinID: NP_001260252
FlyBase: FBgn0032042
UniProt: Q9VLL4
Position
2L
AA seq 442 aa
MGCITSSSKLNELRGHENVFRVRVAHLQPTPGTPIIRSGYLELTPRELIFQSPGCEPIVW
ALQHLRRYGLNNDLFSFEAGRRCMSGPGIYTFRVHNAEQLYPMFQRYINAVNTDAFVQGE
RERVNSAHSVSVNMGRTEGNNYLEPAPLMSRQLGNFHSEPSSTSASYPLQANDSQVDDSP
PNLQSPVLIPSAYLDQPLRALQDCCLEGTASDLLSTPPSGNRLTSRRRTMDLPPLESAPA
PAPVLSPNDAVHMYANVEALIFDLNNERCYENVNRLELPLLPREPISNQEPATPTSLAGS
CGVNYIVLDLDQPRSPVGPAGSSKAINGFGSGLSLISTPAAVTAPVTPEAGTTLDVPPPP
MQTQSLNSISADTGDTQAKKVTECSGTQGYSTIDFIRTYALNKSSTELPETVTHRQHSSH
DAEELRITRHSKCIRKAYSISE
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgggctgcatcaccagcagcagcaagttaaatgagctgcgcggtcatgagaatgtgttt
cgagtgcgagtggctcacctgcaacccaccccgggtacgcccatcatccggagtggctac
ctggagctaacgccccgggaactaatattccagtcgcctggctgtgagcccattgtctgg
gcactgcaacacctccgacgttatgggttgaataacgatctcttctccttcgaagcagga
cgtaggtgtatgtctgggccagggatctacacgtttcgagtccacaatgccgagcagctg
tatccgatgtttcagcgctacatcaacgcggtgaatacagatgcctttgtgcagggcgaa
cgagaaagggttaactccgctcattcggtgtccgtaaatatgggccgtactgagggcaat
aactatctagagccggctcccctaatgagccgccagttgggcaacttccacagtgagccc
tcgagcacaagtgcatcgtatccgctgcaggccaacgattcgcaagtcgatgactctccg
cccaatttgcaatcaccagtcctgatacccagtgcctatttggatcagccattgcgggct
ttgcaggactgttgtctggaaggcaccgcctcggatttgctttccaccccgccctccggc
aataggttgacatcacgtaggcgcacgatggacttgccacctctggaatcggccccagca
ccagctccagttctgagtcccaacgatgctgtgcacatgtacgccaatgtggaagctctg
atctttgatctgaacaatgagcgctgctatgagaacgtaaatcgcttggagctccctctg
ctgccgagggaaccaatttccaatcaagagccggccacgcccaccagcttagcgggcagc
tgcggagtaaactatatagtgctggatcttgatcagccgcgaagtcccgtgggaccggcg
ggttcatcaaaggcgatcaatggatttggcagcggcttatcactgatctccaccccagca
gctgtcaccgcaccagtaactccagaggcaggtactacgttggacgttcccccaccgccc
atgcagacccaaagcctgaatagcatctctgctgatacgggagatacgcaggcgaagaag
gtaacagaatgctccgggacacaaggctattcaaccatcgacttcatccgcacatacgcg
ttgaacaagtcttcgactgaactgccagaaacagtgacgcatcgacagcattcgtcgcac
gatgccgaggagctgagaatcaccaggcacagcaagtgcatacgaaaggcttactccata
agtgagtga

DBGET integrated database retrieval system