KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1342
Entry
Dmel_CG1342       CDS       T00030                                 

Gene name
Spn100A
Definition
(RefSeq) serpin 100A
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 43642
NCBI-ProteinID: NP_651818
FlyBase: FBgn0039795
UniProt: Q9VA48
Position
3R
AA seq 649 aa
MKAVLCAIFVTLLAAIGQGLPTQLEDENHGSFAGQVSQLIALQLLKFNKDIDANQVHSPL
GVASILAMLAEASEGDTYSEFEQVFGYPKDRTKLRDAYKRILGSYQNRDAAVALPSFQTW
LYIYRNNSAREEFKDLLEKHYYVDVKDISRQEYDWNEPNTSLQLSEEKDNTDSTEGSTEQ
SNSKDVIGFETLKRIKLDDEDIPAIPSDGYGQEIIDKEASKFDRDVDDKQYVEKPVAQAE
AELLQKEQKQQATTESELESQPEETTTLSVEKQEKPDMAAEENPAEKQQNKRSDQEESQI
KNLEENETVQEEEKLAKIMAAPALTAGEPEKVRLPLQKLENAVKTAAKDGADEIMLALES
HLPSVSRVNGARSLFQQDDITSALSANSITGRSAGSKSKMLLFNGLYYRGSWANPFYQLR
DGSDEFFFMTNEDAVKAPMMHARGKFQVADLPQVKARVLSLPYETSRYALCIVLPDETEG
LSDVISQLQTSDFLLAKKQFQMKELHISMPKFQVEETSRSEAMLKQMGLKKVFSRTEAQL
SLLSEDPDVHVDEIVQFVNVRVDEGGSSANSLSAATMQARTPSVESTVLPVPEPEPELPG
VERFEVNRPFAYFIVDCQEQFVLASGKIYTPEFKEDLPSVSIEVELEQS
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgaaagcggttctctgcgcgatttttgtaactttgctggccgctattggccagggattg
cccactcagttggaggatgagaatcatggatcctttgccggccaagtttcccagctgatt
gctctgcagctgctgaagttcaacaaggacatcgatgccaatcaggtgcattctccattg
ggagtagcttctattctggccatgctggcggaggcttccgaaggcgatacctactcggag
tttgagcaagtcttcggttaccccaaggatcgcaccaagttgagggatgcctacaagagg
atcctgggaagctaccagaacagagatgctgccgtggccctgccctccttccaaacctgg
ttgtacatctaccggaataacagtgcccgcgaggagttcaaggatctgctcgagaaacac
tactatgtggatgtgaaggatatcagtcggcaggagtacgactggaatgagcccaacacc
tcgctgcaactttcagaggaaaaggacaacacggattccacagagggaagcaccgaacaa
agcaacagcaaggacgtcataggattcgagaccctaaagagaattaagctggatgacgag
gacatccctgccattccatccgatggctatggccaggaaatcatcgacaaagaggcctcc
aagttcgatcgcgacgtggacgacaagcaatatgtggaaaaaccagttgcccaggctgag
gccgagctactgcagaaagaacagaagcagcaggccaccacagaatctgaattggaatcc
cagcccgaggaaaccaccactctttctgtggaaaaacaggaaaaaccagacatggcagcc
gaggaaaatccagcagaaaagcagcagaacaagcgcagcgaccaggaggagagccagatc
aagaacctcgaggagaacgagactgtgcaagaggaggagaagctggccaagatcatggca
gctcccgctttgaccgccggtgaacccgagaaggtgcgtctgcccctccagaagttggag
aatgccgtgaagacggcggccaaggatggcgctgatgaaatcatgctcgctctggagtcg
cacctaccttctgtcagtcgggtcaatggcgcacgaagtttgttccagcaggatgacatc
acgtctgccctaagtgccaactccatcacgggacgatcggcaggatcaaagtccaagatg
ctcctctttaacggactctactaccgcggcagctgggccaatcccttctatcagctgcga
gatggcagcgatgagtttttcttcatgaccaacgaggacgccgtgaaggctccaatgatg
catgcccgtggcaaattccaggtagcagatcttccacaggtcaaagcccgagttctaagc
ctgccctacgaaacctcccgatatgccttgtgcattgtcctgccggacgaaacggaggga
cttagtgatgtgatttcccagctgcagacgagtgacttcctgttggccaagaagcagttc
caaatgaaggagctgcatatttcgatgcccaaattccaagtggaggagacctcacgctcc
gaggcaatgctcaagcagatgggcttaaagaaggtcttctcgaggaccgaagctcagttg
agcttgctgtccgaggatcccgatgtccacgtggatgagatagtccagttcgtaaatgtt
cgcgtggacgagggaggcagcagtgccaattccctgtcagctgccaccatgcaggccaga
actcccagcgtggagtccacagttctcccagttccggaacctgaacccgaattgccagga
gtggaacgcttcgaggtgaatcgtccttttgcctacttcatcgtcgactgccaggagcag
ttcgtcctggcctccggaaaaatctacacgcccgagtttaaggaagatctgccctcagtc
tccatcgaagtggagctggagcagtcttag

DBGET integrated database retrieval system