KEGG   Drosophila melanogaster (fruit fly): Dmel_CG13744
Entry
Dmel_CG13744      CDS       T00030                                 

Gene name
CG13744
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 35906
NCBI-ProteinID: NP_610439
FlyBase: FBgn0033363
UniProt: A1Z7M5
Position
2R
AA seq 389 aa
MQLLLWLCLCLLLLICQSSPSQANILNTLLGVPAECVHQSGVWPCKLSFSCWLQGGKHAK
GCGSNKWLFSCCVAETQHPHQQQHHSPSSPLANLVDYGKLKLNLNSLPKRIMLRRRDDNE
LLNPKPECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRIAEYQCGGVLISANMVATAA
HCIQQAHLADITVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIAL
LKLAQPTSFTEHILPICLPQYPIRLIGRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITT
LDCIRWHESKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFG
CGVDHQPGIYHNVQKTVRWIQEVVARNEP
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgcagttgctattgtggctgtgcctgtgcctcctcctgctcatctgtcagtctagtccc
agtcaagccaatattctgaacaccctactgggggtgcccgcggaatgcgtccaccagagc
ggcgtatggccctgcaagctgagcttctcctgctggctccaaggcggcaagcacgcaaag
ggatgtggcagcaacaagtggctcttcagttgctgcgtcgccgagacacagcatccgcac
cagcagcagcatcactccccctcctcgccgctggccaacctggtggactatggaaagctg
aagttgaacctcaacagcctgcccaagcggatcatgctgcgccgacgtgacgacaacgag
ctgctcaatcccaagcccgagtgtggagttcctcggacggcgcagaacacgcttcagaag
cgcattattggcggtcggccagcgcagtttgcggagtatccgtggcaggcgcacatccgc
atcgcggagtatcaatgcggtggagtgctcatctcggccaacatggtggccactgccgcc
cactgcatccagcaggcccacctggcggacataaccgtgtacctgggagagctggacacg
caggatctgggtcacatacacgaaccgctgcccgtggagaagcacggagtgctacagaag
atcatccatccgcgcttcaacttccgcatgacccagccggataggtatgacatagccctg
ctgaagctggcccagccgacgtcctttacggagcacatcctgcccatctgcctgccgcag
tatccgatccggctgattgggcgcaagggcctcattgcaggatggggcaagacggaggcg
cacatgggccacgcgggcaccaacatgctgcaagtcgccagtgttcccatcataaccaca
ctggattgcattcgctggcacgagagcaaacagataaatgtcgagatcaaggccgaaatg
ttttgcgccggacactccgatggacacatggatgcctgcttgggtgactccggaggaccg
ctggtgatcaaggagcgcggtcgctttgtgcttgtgggcataaccagtgcaggcttcggc
tgcggagtagatcatcagccaggaatttatcataacgttcagaagactgtgaggtggata
caggaagtggtggcccgcaacgagccatag

DBGET integrated database retrieval system