KEGG   Drosophila melanogaster (fruit fly): Dmel_CG13772
Entry
Dmel_CG13772      CDS       T00030                                 
Symbol
Nlg2
Name
(RefSeq) neuroligin 2, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: COesterase Abhydrolase_3 BD-FAE SUIM_assoc
Other DBs
NCBI-GeneID: 33962
NCBI-ProteinID: NP_001245916
FlyBase: FBgn0031866
UniProt: Q9NGK5
Position
2L
AA seq 1248 aa
MAQTKIIQSRFLHIYGLLCLGSLMGCIKTIGASIAQQTLADADAPDEAKAKEREAETDAD
ADAEGDAKAETETGKGTREHTNGDAEADARIMATGICIIRLITLKRFLENSKTEEHNQRR
QQSATSAASAAPAGATSPRRRHLHYPGHSAVQPGHPEACALLVLLLLTSLWPDCCECLHG
GSNTVKTKYGLLRGIVVRSSPLVEAFLGIPYASPPVGSLRFMPPITPSTWKTVRSADRFS
PVCPQNIPIPPNGPEALLEVPRARLAQLRRLLPLLKNQSEDCLYLNIYVPYETRRQRRNT
DDTTGEPKTKLSTVVFIHGESYDWNSGNPYDGSELAAHGNVIVVTINFRLGIFGFLKTGG
KESAQGNFGLMDLVAGLHWLKENLPAFGGDPQSITLLGYGTGAVLANILVVSPVASDLIQ
RTVLVSGSALSPWAIQKNPLFVKRRVAEQTGCHGDMLYDDLAPCLRTKSVAELLAVKVDH
PRFLVGFAPFVDGTVISPGANPLGSTTLPLGSAIVSTSGIEYANFPKRDLIFCLTSVESY
LDLSAQDLEFGFNETRRDRILRTFVRNNFHYHLNEIFAVLKNEYTDWEKAIRNPLSSRDA
TLQFLSDGHTASPLIKLGYMHSLRGGRAYFLHFKHKTIEEEYPQRSGSVRGEDVPFWLGL
PMSPLFPHNYTTQERQIGRLMLRYLSNFAKTGNPNQSTAKSVLPNPNEVLETALHQQKKR
STSLTHPNLSEALNLAVLYNQRRSNAMHEKRSYIRRRLRSNDAAFTQLGISSERDVGSYD
GDELPFWDAYDVVNQLYVELGNKANIQSHYRGHKLSMWLNLIPQLHRHFNINDQSMRHHQ
FQDDMNNRDLYEGVVRPQLQTKPAEDDNIIIMQRSRTTTPPPPSKNPSTNATQALNPLGT
GTPTTTECGIDGAMSVSELTTTQSPKDNRTGIVRVETQKDLATASTGIIGNLELLRRLGG
KQFQSYTTALIATVAVGCFLLILNVLIFAGIYHQREKRARDAKTKEELQEGDNSKNSSIL
KLNALMGGGGACGSGPGDIADAYTLSGSVVDSKGGVGVVFGEYSCYDEKTKQLKEEKLLV
ELPPSSSTGQTSLMIDNWGACSTSTLDLLKTKPGDPIEMVTYSALPSVMESTSAMSSKRG
SFVDTTLQFNSPQQFDYAVQSSDQMSFKAIEDAVKAAAGHDSEITRDDDIPEPPPPPRSF
LAAQQQQQQQQQQQQTGILRQTGAGGTSTSGSASGSGKKRVHIQEISV
NT seq 3747 nt   +upstreamnt  +downstreamnt
atggcacaaactaagataattcaatcgcgttttctacacatttacggtttactttgcctc
ggttccttgatgggttgcattaaaacaatcggtgcttcaattgcgcagcaaacgcttgca
gatgcggatgcaccagatgaagctaaagctaaagagcgggaagcggaaacggatgcggat
gcggatgcggaaggggatgcaaaagcggaaacggaaacgggaaagggaacgagagagcat
acaaatggggacgcggaagcggatgcccgcatcatggcaacgggaatttgcattataaga
ctgataacattaaagagatttctagagaattccaaaaccgaagaacacaatcaaaggcgc
cagcaatcagcaacgtcagcagcatcagctgcgccagctggtgcgaccagcccgcggagg
agacacctccattatcccggacattcagccgtacaacccggacacccggaggcgtgtgcc
ctgctagtgctcctgctgctcaccagcctctggccggattgctgcgagtgcctccacggc
ggcagcaacaccgtgaagaccaagtacggcctgctgcgaggcatcgttgtccgctcctcg
ccgctcgtggaggccttcctgggcattccctatgcatcgcccccggtgggcagtctcaga
tttatgccccccataacaccatcgacgtggaaaacggttcgcagcgcggatcgattctcg
ccggtctgtccgcagaacatacccataccgcccaacggaccggaggcgctactggaagtg
ccccgcgcccgtctcgcccagctgcgccgcctgttgccgctgctgaagaaccaatcggaa
gactgcttatacctaaatatctatgtgccctacgagacgcgtcgccagagacgtaacacc
gatgataccaccggcgaaccgaagaccaaactgtccacggtggtgttcatccatggcgaa
tcgtacgactggaactcaggaaatccctacgatggctccgagctggctgcccacggcaat
gtcatcgtcgtgacaatcaatttccgtttgggaatctttggattccttaagaccggcggc
aaggagagtgcccagggaaacttcggactgatggacctggtggcgggtcttcactggctc
aaggaaaatctgccggcatttggcggggatcctcagagcatcacactactgggctacgga
actggagctgtgctggccaacattctagttgtgtctccagtggcaagtgacctaatccag
cgcacggttctggtgagcggctccgccctgtcgccttgggccattcaaaagaatcccctt
tttgtgaagaggcgcgtggcggaacagactggatgccacggcgacatgttgtacgacgac
ctggccccctgcctccgcaccaagagcgtcgccgaattgctggccgtcaaggtggatcat
ccacgatttctcgtgggcttcgctccatttgtggacggcactgttatatcgcctggcgcc
aatcctttgggcagcaccacattgccccttggatcagctattgttagtacttcaggaatt
gaatatgcaaactttccgaaacgagacctcattttctgccttacatctgtggagtcctat
ttggatttgagtgcccaggacttggagttcggcttcaatgagacgcgacgggatcgcatc
ctgcgcacttttgtgcgaaacaactttcactatcatctgaacgagatatttgccgttcta
aagaacgagtacaccgactgggagaaggccatccgtaatcctcttagctcccgagacgcc
accctgcaattcctgagcgatggccacacggcctcgccgctgattaagttgggctacatg
cacagtttgcgtggaggtcgggcctactttctgcactttaaacacaagaccatcgaggag
gagtacccacagagatccggctccgtgcgcggcgaagatgtgcctttttggctgggtctg
ccaatgtccccgctctttccgcacaactacaccacccaggagcgacaaatcggtagacta
atgctgcgatatctgtccaactttgccaaaactggcaatccgaatcaatccacggcaaag
tcagtgcttcctaatccgaacgaggtcttggagactgcactgcatcagcagaagaagcgc
tccactagtctgactcatcccaatctcagtgaggccctcaatctggcagtgctctacaat
cagcgaaggagcaatgcgatgcacgagaagcgatcctacatacgaagaagactgcgtagc
aatgatgcagccttcacccagctgggaatctctagtgaacgggatgtgggcagctacgat
ggcgatgagctgccattttgggatgcctacgacgtggtcaatcagctgtacgtggaattg
ggaaacaaggccaacattcagagccactaccgtggtcataagctgtccatgtggttgaac
cttattcctcagctacatcgccatttcaacatcaatgaccagtctatgcgacaccatcag
ttccaggacgacatgaacaacagggatctctacgagggcgttgtgcgaccacaattgcag
actaagccagctgaagatgataacatcatcatcatgcagaggagcagaacaacgacgcca
ccgccgccctcaaagaatccgagtacaaatgccacgcaagccttaaatccgcttggcacg
ggaacacctaccaccacagagtgcggcatcgatggagccatgtccgtatcggaactaacc
accactcagtcgccaaaggacaatagaactggaatagtgcgcgtggagacccagaaggac
ctggccaccgcgtcgactgggatcattggcaacctggagctgttacgccgtctgggaggc
aagcagtttcaaagctatacgacagccctgatagccaccgtggccgtgggctgcttcctg
ctaatcctgaatgtcctgatcttcgcgggcatttatcatcagcgcgagaagcgagcgcga
gatgcgaagaccaaggaggagctgcaggagggcgataacagcaagaactccagcatcctg
aagctcaacgctctgatgggcggcggaggagcatgtggttctggtccaggcgacatagcg
gatgcgtataccttgagcggctccgtggtggacagcaagggcggagtgggcgtcgtgttc
ggggagtatagctgctacgatgagaagaccaagcagctgaaggaagagaagctgctggtg
gaactgccaccatcatcgtcgacgggccagacgtctttgatgatagacaattggggcgcg
tgttccacgagcactttggatctgttaaaaacaaagccaggcgatcccatcgaaatggtg
acctacagtgcgctgccctcggtaatggaatcaacatcggccatgagcagcaagcgtgga
tcgtttgtggacaccaccctgcaattcaacagtccgcagcaattcgactatgctgtgcag
tcctcggatcagatgtcctttaaggcgatagaggatgcagtgaaagcggcggcagggcat
gactcggaaatcacgcgggatgatgacattcccgaaccgccgccaccaccacgatccttt
ctggcagcccaacagcaacaacaacagcagcagcagcagcagcaaacaggaatcctgcga
cagacaggagcaggtggcacttccacgtcgggatcggcgagcggcagcggcaagaaacgt
gtacatattcaggaaatctcagtctag

DBGET integrated database retrieval system