KEGG   Drosophila melanogaster (fruit fly): Dmel_CG13773
Entry
Dmel_CG13773      CDS       T00030                                 

Gene name
CG13773
Definition
(RefSeq) uncharacterized protein
  KO
K03004  DNA-directed RNA polymerase I subunit RPA43
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    Dmel_CG13773 (CG13773)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dme03021]
    Dmel_CG13773 (CG13773)
Transcription machinery [BR:dme03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     Dmel_CG13773 (CG13773)
SSDB
Motif
Pfam: RPA43_OB
Other DBs
NCBI-GeneID: 33963
NCBI-ProteinID: NP_609081
FlyBase: FBgn0042092
UniProt: Q9VM72
Position
2L
AA seq 253 aa
MAKILQKYIKFSVKELENYASSPESCVRCITTDMHLAMGPYGMANFKHALHELLIRTKVG
FYDSGLDGIVLGIKNIKVLGQTAGLRADDPTMHLVINADFYVFRPKAGAILSGVVRHISR
HHVSAVIYRVFNTSIRFTNQSASREDIAMDQEIKIRIKNFDISNLMPYIEGELLLENGEA
PKNKSIKFGSPPPEEKEVKKEDPDEMLDALITEIKKEPEFTPRKKTSTKRKNGENGDTTK
TKKVKKEIKSEPI
NT seq 762 nt   +upstreamnt  +downstreamnt
atggccaagatactgcagaaatacattaaattttcggtcaaggagctggaaaactatgcc
agcagcccggagtcatgcgtgcgttgcatcaccacggacatgcacctagcaatgggcccg
tacggcatggccaatttcaagcacgcgctccacgagctccttatccgtaccaaggtggga
ttctatgactcggggctcgacgggatcgtcctcggaatcaagaacatcaaggtgctcggt
caaacggcgggtctacgcgcagacgatcccaccatgcatctggtcataaatgcggacttt
tatgtcttccgaccgaaggcgggcgccattctgagcggcgtggtgcgacacatctccagg
caccatgtcagcgccgtcatttaccgggtcttcaacacctccatacgtttcacaaaccag
agtgcaagtcgcgaggacatcgccatggaccaggagatcaagatccgcataaaaaacttc
gatatcagcaacttgatgccttacatcgagggagaactattgctagagaatggcgaagct
ccaaagaacaaatccattaagtttggcagtcccccaccggaggagaaagaagtcaagaaa
gaggacccagatgagatgttagatgctcttataacagaaattaagaaagaacctgaattc
acgccgagaaagaaaacttcaacaaaacgcaagaatggggaaaacggtgacactacaaag
acgaaaaaagtgaaaaaagaaataaaaagcgagccgatatag

DBGET integrated database retrieval system