KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1378
Entry
Dmel_CG1378       CDS       T00030                                 

Symbol
tll
Name
(RefSeq) tailless
  KO
K08545  nuclear receptor subfamily 2 group E member 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG1378 (tll)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG1378 (tll)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:dme03310]
    Dmel_CG1378 (tll)
Transcription factors [BR:dme03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    Dmel_CG1378 (tll)
Nuclear receptors [BR:dme03310]
 2. Hepatocyte nuclear factor 4 like
  2E. Tailless like receptor
   Dmel_CG1378 (tll)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 43656
NCBI-ProteinID: NP_524596
FlyBase: FBgn0003720
UniProt: P18102
Position
3R
AA seq 452 aa
MQSSEGSPDMMDQKYNSVRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKR
SIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRH
MAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPS
AAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHL
FKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLFVYESENANR
EIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLANSSILTG
SGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRFQTLLGVVQLMHKV
SSFTIEELFFRKTIGDITIVRLISDMYSQRKI
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgcagtcgtcggagggttcaccagacatgatggatcagaaatacaacagcgtgcgtctt
tcgccagcggcatcgagtcgcattctataccatgtgccctgcaaagtctgcagagatcac
agctccggcaagcattacggcatctacgcctgtgatggctgcgccggattcttcaagagg
agcattcggagatcccggcagtatgtgtgcaagtcgcagaagcagggactctgtgtggtg
gacaagacgcacaggaaccaatgtagggcttgccgactgaggaagtgctttgaggtcgga
atgaacaaggatgcagtgcagcacgagcggggaccgcggaactccactctgcgtcgccac
atggccatgtacaaggatgccatgatgggcgccggcgagatgccacaaatacccgccgaa
attctgatgaacacggctgccttgaccggctttcctggagtaccgatgcccatgcctggc
ctgccccagagggctggtcatcatcctgctcacatggctgccttccagccgccaccatcg
gctgccgctgtcttggacttatccgtgccacgagtgccccatcacccggtgcaccaagga
caccacggtttcttctcgcccaccgccgcctacatgaatgccctggccactcgggccctg
ccccccactcctccgctgatggcagctgagcacatcaaggaaaccgcggcggaacaccta
ttcaagaacgtcaactggatcaagagcgtacgggccttcaccgaactgcccatgccggat
cagctgctcctgctggaggagtcctggaaggagttcttcatcctggccatggcccagtac
ctaatgcccatgaatttcgcccagctgctgttcgtctacgagtccgagaatgccaaccgg
gagatcatgggcatggtgacccgcgaggtgcacgccttccaggaggtgctgaaccaactg
tgccatctgaacattgacagcaccgagtacgagtgtctgagggctatttcgctcttccgt
aagtcaccaccgtcggcaagttctaccgaggatttagccaacagctcaatcctgacagga
agcggcagcccgaactcctcggcctctgctgaatccaggggtcttctggagtcgggaaaa
gtggcggccatgcacaacgatgcccggagtgcgctgcacaactacatccagaggacccat
ccctcgcagcccatgcgattccagacgctcttgggcgtggtgcagctgatgcacaaggtc
tcaagcttcaccatcgaggagctgttcttccgaaagaccatcggcgacatcaccattgtg
cgcctcatctccgacatgtacagtcagcgcaagatctga

DBGET integrated database retrieval system