KEGG   Drosophila melanogaster (fruit fly): Dmel_CG13852
Entry
Dmel_CG13852      CDS       T00030                                 

Gene name
mats
Definition
(RefSeq) mob as tumor suppressor, isoform B
  KO
K06685  MOB kinase activator 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04391  Hippo signaling pathway - fly
dme04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway - fly
    Dmel_CG13852 (mats)
   04392 Hippo signaling pathway - multiple species
    Dmel_CG13852 (mats)
SSDB
Motif
Pfam: Mob1_phocein
Other DBs
NCBI-GeneID: 42634
NCBI-ProteinID: NP_001262835
FlyBase: FBgn0038965
UniProt: Q95RA8 A0A0B4KGK3
Position
3R
AA seq 219 aa
MDFLFGSRSSKTFKPKKNIPEGTHQYDLMKHAAATLGSGNLRNAVALPDGEDLNEWVAVN
TVDFFNQINMLYGTITEFCTEETCGIMSAGPKYEYHWADGLTVKKPIKCSAPKYIDYLMT
WVQDQLDDETLFPSKIGVPFPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLN
TSFKHFIFFVQEFNLIERRELAPLQELIDKLTAKDERQI
NT seq 660 nt   +upstreamnt  +downstreamnt
atggacttcttgttcggttcccgttccagcaagaccttcaagcccaagaagaacatcccg
gaaggcacacaccaatatgatctcatgaagcatgcggcagccacgctgggatcgggaaac
ctgcgcaatgcagtggcccttccagatggcgaggatctcaacgagtgggtggccgttaac
accgtggactttttcaaccagatcaacatgctgtacggcaccatcaccgagttctgcacc
gaggagacctgtggcatcatgtcggctggtccgaaatacgagtaccactgggccgacggt
ttgaccgtaaagaagcccatcaagtgcagcgcgcccaagtatattgactatctgatgact
tgggtgcaggatcagctggacgacgagaccctgtttccctccaagatcggcgtgccgttt
ccaaagaactttcactcctccgccaagaccatactgaagcgtctgttccgcgtgtatgcg
cacatctaccaccagcacttcacagaggtggtgacgcttggcgaggaggcccatctcaac
acgtccttcaagcacttcatcttcttcgtgcaggagttcaatctgattgagcggcgcgaa
ctggccccgctgcaggagctcatcgacaagctgacggctaaggatgagcggcagatatag

DBGET integrated database retrieval system