KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1391
Entry
Dmel_CG1391       CDS       T00030                                 

Gene name
sol
Definition
(RefSeq) small optic lobes, isoform B
  KO
K08582  calpain-15 [EC:3.4.22.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG1391 (sol)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     Dmel_CG1391 (sol)
Peptidases and inhibitors [BR:dme01002]
 Cysteine peptidases
  Family C2: calpain family
   Dmel_CG1391 (sol)
SSDB
Motif
Pfam: Peptidase_C2 zf-RanBP 30K_MP_C_Ter
Other DBs
NCBI-GeneID: 44014
NCBI-ProteinID: NP_476738
FlyBase: FBgn0003464
UniProt: P27398
Position
X
AA seq 1594 aa
MGTISSVLQWSCTKCNTINPTESLKCFNCGTVRKVFPQQQQQQHRSSSITASWTADDALE
QEQAEKGQERDKEKGRAAVARSEYKHVYKSLLRGCLKRPQRNSQNLPANCVDCEDTRKYI
KSSIELYRHFSNPALNRRWVCHACGTDNSSVTWHCLICDTVSYLAPIYKDAIAADRGQDL
AGSLGNRGELLAADHSHPHHHHHYLHQELEEQHQHQLHSQHLHKRHLKGRSASGSGSGPG
SGSGLRRTQSLSTAIDKSASGRSCHICYANNQSKDIFNLPQIKPAPQLTGIPPVAACSNS
RFAIANDTFCRRKQNNNNKNQNHKVVRESGAKRKYNFTITTLSRSAAKDAGHGQMKPLRQ
VVNLNLNLQQEPQQKSPANPQQLQRKTQREPAAVSMNPTQFTIPRNGVFIAVNEWSEPMA
SSSSVSSSSNHHHHHHSNSNSNSSGNSNIINNNSSSSSGSNKLYENECVALAQQQLRAAA
AQAAQAAATAVAIASSPSAKAMAEPAPTATMPIYAQVNKQHKLKKKQQIASESQTNNNTG
SGEIADAVSESLTAGLGTSTDGSGEASESESQVEEHSIYAKVWKGPRKATESKIMHDPGS
SSRLSGAASAAAGTASAGAIAAAVGAAAASRHDNKTQLGNGSRSKMWICIKCSYAYNRLW
LQTCEMCEAKAEQQQQQLQLQQQQQQQQQHHHHHLQQQQAEAPRDEPWTCKKCTLVNYST
AMACVVCGGSKLKSISSIEDMTLRKGEFWTCSHCTLKNSLHSPVCSACKSHRQPQLSMAM
EAVRERPDGQSYEEQDAAAVGGGGGSAHQSGANEVKAPTALNLPLTSVALPMPMLQLPTS
TAAGLRGSRSPSPRMQLLPSLQQQRNSSSSGAIPKRHSTGGSIVPRNISIAGLANYNLQQ
GQGVGSASVVSASGAGSGAGAVGASTSTKKWQCPACTYDNCAASVVCDICSSPRGLASAV
LGEALGRKSVRVALTPADIRQESKLMENLRQLEETEALTKWQNIIQYCRDNSELFVDDSF
PPAPKSLYYNPASGAGEGNPVVQWRRPHEINCDGGAYPPWAVFRTPLPSDICQGVLGNCW
LLSALAVLAEREDLVKEVLVTKEICGQGAYQVRLCKDGKWTTVLVDDLLPCDKRGHLVYS
QAKRKQLWVPLIEKAVAKIHGCYEALVSGRAIEGLATLTGAPCESIPLQASSLPMPSEDE
LDKDLIWAQLLSSRCVRFLMGASCGGGNMKVDEEEYQQKGLRPRHAYSVLDVKDIQGHRL
LKLRNPWGHYSWRGDWSDDSSLWTDDLRDALMPHGASEGVFWISFEDVLNYFDCIDICKV
RSGWNEVRLQGTLQPLCSISCVLLTVLEPTEAEFTLFQEGQRNSEKSQRSQLDLCVVIFR
TRSPAAPEIGRLVEHSKRQVRGFVGCHKMLERDIYLLVCLAFNHWHTGIEDPHQYPQCIL
AIHSSKRLLVEQISPSPHLLADAIISLTLTKGQRHEGREGMTAYYLTKGWAGLVVMVENR
HENKWIHVKCDCQESYNVVSTRGELKTVDSVPPLQRQVIIVLTQLEGSGGFSIAHRLTHR
LANSRGLHDWGPPGATHCPPIENVHGLHAPRLIT
NT seq 4785 nt   +upstreamnt  +downstreamnt
atgggcaccatctcatccgtgctgcagtggtcgtgcaccaaatgtaacactatcaatccc
acggagtcgctcaagtgcttcaattgcggcaccgtccgcaaggtgttcccccaacaacag
cagcagcagcatcgcagcagcagcatcaccgcctcctggacagctgatgatgcactggag
caggagcaggcggagaaggggcaggagagggacaaggagaagggcagggcggcggttgcc
aggagcgagtacaagcatgtgtacaagtccctgctgcgcggatgcttgaaaagaccacag
cggaacagccagaatctgcccgccaactgcgtggattgcgaggacacgcgcaagtacatc
aagagctctattgagctgtaccgccacttctcgaatccggccctgaatcggcggtgggtg
tgccacgcctgcggcacggacaacagctcggtcacctggcactgcctcatctgcgacacg
gtcagctatctggcgcccatttacaaggacgccatcgccgccgaccgaggccaggatctg
gctggcagcctgggcaatcgcggcgagctgctggcggcggaccattcacatccacatcat
catcaccactacctccaccaggaactggaggagcagcatcagcatcagttacattcccag
cacttgcataagcgccacctcaaaggtagatctgcatccggatcgggatccggaccgggc
tcgggttctggactgcgccgcacccagagcctgagcaccgctatcgacaagagcgcttcc
gggcgcagctgccacatttgctatgcgaacaaccagagcaaggacatcttcaatctgccg
cagatcaagccggcgccgcagctgacagggattccccccgtggccgcctgcagcaactcc
cgttttgccatcgccaacgacactttttgcaggcgcaaacagaacaacaataacaagaac
cagaatcacaaggtggttcgcgagagcggtgccaagcggaagtacaactttaccatcacc
acgctctctcggtcggcggccaaggatgccggccatggccaaatgaagccactgcgtcag
gtcgttaatctaaatctgaatctacagcaggagccgcagcagaagtcaccggctaatccg
cagcagctgcagcggaaaacccagcgggagccagcagcagtgagtatgaatcccacgcag
ttcaccattccgcggaacggcgtcttcatagccgtcaacgagtggtcggagccaatggcc
agcagctcctccgtctcctctagctccaaccatcatcatcaccatcacagcaacagcaat
agcaatagcagcggtaacagcaacatcatcaacaacaacagcagcagctccagcggcagc
aacaagttgtatgagaacgaatgcgtggccctggcccagcagcaactaagagcagctgct
gcgcaggcggcacaggcagccgcgacggcggtggccattgcgagttcgccatcagctaag
gctatggccgaaccagctccaacggctaccatgcccatctatgcgcaggtgaacaagcag
cacaagctcaagaagaagcaacagattgccagcgaatcgcaaacgaacaacaacactggc
agtggcgagatcgcggatgcggtcagtgaatcccttaccgccggactaggcactagcacc
gatggcagcggcgaggccagcgaatccgagtcgcaggtggaggagcactccatctacgcc
aaagtgtggaagggaccgcgcaaggcgaccgagtcgaaaattatgcatgatccagggagc
agcagccgcctatcaggagccgcatccgcagcagcagggaccgcgtcagctggagctata
gctgcagccgtaggagcagctgctgcctcgcggcacgacaataagacacagcttggcaac
ggcagccgcagtaagatgtggatatgcatcaaatgttcctatgcctacaaccgactctgg
ctccagacttgcgagatgtgcgaggccaaagccgaacagcagcaacagcagttgcagctg
caacagcagcagcagcagcagcagcagcaccaccaccaccacttgcagcagcaacaggca
gaagcaccccgcgacgagccatggacctgcaagaagtgcaccctggttaactactcgaca
gcaatggcctgcgtggtgtgcggcggctccaagctgaaaagcatctcttccatcgaggac
atgacgttgcgaaagggcgagttctggacctgcagccactgtacgctcaagaactcgctg
cactcgccggtctgcagtgcctgcaagtcccaccgccagccgcagctctcgatggccatg
gaggcggtacgggagcgaccggatggtcagtcgtacgaggagcaggatgctgcagccgtc
gggggcggaggaggcagtgcccaccaatcgggcgccaatgaggtcaaggcgcctacagcc
ttgaacctaccgctaacttcggtggcgttgcccatgcccatgctgcagcttccaacgtca
acagcggctggtctgcgcggctcacgcagtccctcgcccaggatgcagctgctgccatca
ctccagcagcagaggaactccagctcatcgggcgctatacctaaacgtcacagcaccggc
ggctccattgtgccacggaacatttccatcgctggtctggccaattacaatttgcagcag
ggccagggagtcggctccgcatcggtagtgtctgcttctggagctggatctggagctgga
gctgtcggagccagtaccagcacaaagaagtggcagtgtcccgcgtgcacgtacgataac
tgtgccgcttccgtcgtttgtgacatctgctcgagtccgcgcggcctggcgagcgcagtt
ttgggcgaggcgttgggcagaaagtccgttcgagttgccctcacaccggcagatattcgg
caggagagcaagctgatggagaaccttcgccagctggaggagaccgaagcgttgaccaag
tggcaaaacatcatacagtactgtcgcgacaatagcgagcttttcgtggacgattcgttt
ccgccggcgccgaagagtctgtactacaatccggcgagcggagcaggcgagggaaatcct
gtggtgcagtggcgacggccgcacgagattaactgcgacggcggagcgtatccaccgtgg
gctgtgttccgcaccccgctgccctcggacatctgccagggcgtcttgggcaactgctgg
ctactcagtgcgctggcggtgctggcggagcgcgaagatctggtcaaggaggtgctggtc
acgaaggagatatgtggccagggcgcataccaggtgcgcctctgcaaagacggcaagtgg
acgacggtgctggtggatgatctgctgccatgcgacaagcgtggccatctggtttattcg
caggccaagcgcaagcagctatgggtgccgctgatcgagaaggctgtggccaagatccac
ggctgctacgaggcgctggtctcgggccgggcgatcgagggactggccacgctgacagga
gcgccttgcgagagcattccactacaggccagtagcttgcccatgcccagcgaggacgaa
ctggacaaggacctgatatgggcccagctgctgagctctcgatgcgtacgattcctcatg
ggcgccagctgtggcggtggcaacatgaaggtggacgaggaggagtaccagcagaagggg
ctgcgcccgcgacacgcctactcggtgctggacgtgaaggacatccagggacatcgcctg
ctcaagctacgcaatccgtggggtcactattcgtggcgtggcgattggtcggatgactcc
tcgctgtggacggacgatcttcgggatgctctgatgccgcacggcgccagcgagggcgtc
ttctggatctcgttcgaggatgtgcttaactacttcgactgcatcgatatctgcaaggtg
cgctccggctggaacgaggtgcgtctgcaggggacattgcagcccctgtgctccatctcc
tgtgtgctgctcaccgtgctggagccgacggaggcggagtttaccctattccaggagggg
cagcgcaactcggagaagtcgcagcgatcgcagctggacctgtgcgttgtgatattccgc
acccggtctccggcggcgccggaaatcggtcgattagtggagcacagcaagcgtcaggtg
cgaggctttgtgggatgccacaagatgctggagcgggacatttacctgcttgtgtgtctg
gccttcaaccattggcacacgggcatcgaggatccccaccagtatcctcaatgcatccta
gcgatacacagctccaagcgtctgctggtggagcagataagtccctcgccgcatctcctg
gccgacgctatcattagcctgaccctaaccaagggacagcggcacgaggggcgcgagggg
atgaccgcctactatctgaccaagggctgggcgggtctggttgtgatggtggaaaataga
catgagaataagtggatccatgtgaaatgtgattgccaggagagctacaatgtggtgtcg
acacgcggcgaactcaagacagtggactctgtgcccccgctgcagagacaagtaatcatc
gttctcacccaactagagggcagtggcggcttcagcatcgcccaccggctgacccatcgt
ctggcgaattcccgcggcctgcacgactgggggccacccggcgccacccactgcccgccc
atcgagaatgtccatggactgcacgctccgcggctaatcacctag

DBGET integrated database retrieval system