KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1394
Entry
Dmel_CG1394       CDS       T00030                                 

Symbol
CG1394
Name
(RefSeq) uncharacterized protein, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Other DBs
NCBI-GeneID: 32059
NCBI-ProteinID: NP_001285115
FlyBase: FBgn0030277
UniProt: Q9VZ18
Position
X:complement(11169811..11170678)
AA seq 167 aa
MSNSFSYWNGQPLNAPVYPQMGDFMQHSAAGAAAPPPLSATAAAPGLGSAGGLGGWPSQG
AAQAHSMLPYAGGAGGMPAAMPGAMPGVMPGAMSGAMPGAMPGAMSCGMPITGAQHIVPP
PVDRSIYGDIPGRNEPCIDNGEAFCAYNGMDMSMNYGGGSASKGGFW
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtcgaattcgttttcgtactggaatggccagccgttgaatgctcccgtttatccgcag
atgggtgacttcatgcagcactctgccgctggagcagccgctccaccaccactatcagca
acagcagcagcaccaggattaggatcagccggcggactaggaggttggcctagccagggc
gcagctcaggcacactccatgctaccatacgccggaggagccggtggcatgccggctgcc
atgccgggtgccatgccgggcgtcatgccgggtgccatgtcgggtgccatgccgggtgcc
atgccgggtgccatgtcgtgtggcatgcccattacaggagcccagcatatagtgccgcca
cccgtggaccgttcaatatatggagacatacccggacgaaatgaaccgtgcatcgacaat
ggcgaagccttctgcgcctacaacggcatggacatgagcatgaactacggcggaggcagt
gcatccaagggtggcttctggtag

DBGET integrated database retrieval system