KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1395
Entry
Dmel_CG1395       CDS       T00030                                 

Gene name
stg
Definition
(RefSeq) string, isoform B
  KO
K16723  M-phase inducer phosphatase [EC:3.1.3.48]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG1395 (stg)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     Dmel_CG1395 (stg)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     Dmel_CG1395 (stg)
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-GeneID: 43466
NCBI-ProteinID: NP_001263066
FlyBase: FBgn0003525
UniProt: P20483 A0A0B4KI54
Position
3R
AA seq 479 aa
MLWETIVEENNCSMDCNISNNTSSSSSINKMSGSRRARRSLELMSMDQEELSFYDDDVVP
QDQQRSASPELMGLLSPEGSPQRFQIVRQPKILPAMGVSSDHTPARSFRIFNSLSSTCSM
ESSMDDEYMELFEMESQSQQTALGFPSGLNSLISGQIKEQPAAKSPAGLSMRRPSVRRCL
SMTESNTNSTTTPPPKTPETARDCFKRPEPPASANCSPIQSKRHRCAAVEKENCPAPSPL
SQVTISHPPPLRKCMSLNDAEIMSALARSENRNEPELIGDFSKAYALPLMEGRHRDLKSI
SSETVARLLKGEFSDKVASYRIIDCRYPYEFEGGHIEGAKNLYTTEQILDEFLTVQQTEL
QQQQNAESGHKRNIIIFHCEFSSERGPKMSRFLRNLDRERNTNAYPALHYPEIYLLHNGY
KEFFESHVELCEPHAYRTMLDPAYNEAYRHFRAKSKSWNGDGLGGATGRLKKSRSRLML
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgctgtgggaaactattgtggaggaaaacaactgcagcatggattgcaatatcagtaat
aacaccagcagttcgagtagcatcaacaaaatgagtggatctcgtcgtgctcgccgttcc
ctggaactgatgagcatggaccaggaggagctgtcgttctacgacgacgacgttgtgccc
caggatcagcagcgatcggccagtccggagctgatgggtctgctctcgccggagggctcg
ccccagcgcttccagatcgtccgccagccgaaaattctgccagctatgggagtatcaagt
gatcacacgccggcgcgcagcttccgcatcttcaacagcctgtcctccacatgctccatg
gagtcctccatggacgatgagtacatggagctcttcgagatggagtcgcagagccaacag
accgccctgggcttccccagtggcctaaactcgctgatcagcggccagatcaaggagcag
cctgctgccaaatcgccagcgggtctgtccatgcgccgcccttcggtcagaaggtgcctc
agcatgacggagagcaacaccaacagcaccaccaccccaccaccaaagaccccagagact
gcccgggattgcttcaagcgcccggaaccgccagcatcggccaactgctcgcccatccag
agcaaacgccatcgctgcgccgccgttgagaaggagaactgccccgcacccagcccactc
agccaggtcacgattagccacccccctccactgaggaagtgcatgtccctgaacgacgcc
gagatcatgtccgccctggcccgctccgagaaccgcaacgagcccgagctaatcggcgac
ttcagcaaagcctatgccctgcccctgatggagggtcgtcatcgggatctgaagagcatc
tccagcgaaacagtggctcgcctgcttaagggcgagttcagcgataaggtggccagctac
cgcatcatcgactgccgctacccctacgaattcgagggcggccacatcgagggagccaag
aacctgtacaccaccgagcagatcctcgatgagttcctcaccgtccaacagactgagctg
cagcagcagcagaacgccgaatcgggacacaagcgcaacatcattatcttccactgcgaa
ttctcctcggagcgtggaccgaaaatgtcccgcttcctgcgtaatctggatcgcgagagg
aataccaacgcctatccggcgttgcactatcccgagatctatctgctgcacaacggctac
aaggagttcttcgagtcgcacgttgagctgtgcgaaccacatgcctaccgcaccatgctg
gatcccgcctacaacgaggcctatcgccactttcgcgccaagtccaagtcctggaacggc
gatggcctgggcggtgccaccgggcggctaaagaagtcgcgctcgcgactgatgctgtag

DBGET integrated database retrieval system