KEGG   Drosophila melanogaster (fruit fly): Dmel_CG13969
Entry
Dmel_CG13969      CDS       T00030                                 

Gene name
bwa
Definition
(RefSeq) brain washing, isoform A
  KO
K01441  alkaline ceramidase [EC:3.5.1.23]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00600  Sphingolipid metabolism
dme01100  Metabolic pathways
Module
dme_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Dmel_CG13969 (bwa)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     Dmel_CG13969 (bwa)
SSDB
Motif
Pfam: Ceramidase Toxin_YhaV
Other DBs
NCBI-GeneID: 250736
NCBI-ProteinID: NP_610020
FlyBase: FBgn0045064
UniProt: Q9VIP7
Position
2L
AA seq 283 aa
MGGMGGGGLLDIYAMAWEHLRPGSSPVDWCEGNYLISSNIAEFVNTFSNFLFILLPPVLI
MLFKEYGRFVTPGIHVIWVLLIVVGLSSMYFHATLSLIGQLLDELAILWVFMAAFSLFYP
KRYYPKFVKNDRKTFSWLMLLSAIAATGLSWWKPIVNAFVLMFMSVPTMVMLYTELQRVS
DQRVYRLGIRSTTVWAVAVFCWINDRIFCEAWSSINFPYLHGFWHIFIFIAAYTVLVLFA
YFYVESELPQRQPLLKYWPKNEFEFGIPFISIRNPGKALRNTI
NT seq 852 nt   +upstreamnt  +downstreamnt
atgggcgggatggggggcggcgggctgctggacatctacgccatggcctgggagcaccta
agacccggaagctcgcccgtcgactggtgcgaaggcaactacttgatttcgtccaacatc
gccgagttcgtgaacacgtttagcaacttcctgttcatcctactgccgcccgtccttata
atgctcttcaaggagtacggacgctttgtgacgcccggaatccacgtcatctgggtgctg
ctcatcgtggttggcctgagttcgatgtacttccatgccactttgagtctgattggccag
ctgctggacgaactggccatactctgggtcttcatggcggccttttcgctcttctatccg
aagcgatactatcccaagttcgtgaaaaacgatcgcaaaaccttcagttggctcatgctc
ttgtcggcgattgctgcgacgggcttgtcgtggtggaagcccattgttaacgcctttgtt
ctcatgttcatgagtgtgccgaccatggtaatgctctacacagagctgcagagagttagt
gaccagagggtctaccgcctgggcatccgatcgacgaccgtctgggctgttgcggtgttc
tgctggatcaatgaccggatcttctgcgaggcctggtcctcgatcaattttccatacctg
cacggcttctggcacatattcatttttatagccgcctacacggtgctggtgcttttcgcc
tacttctacgtggaatcggagctgccccagcgacagccgctgctgaagtactggccaaag
aacgagttcgagttcgggatacccttcatttcgatccggaatccaggtaaggctctgcgc
aacaccatctaa

DBGET integrated database retrieval system