KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1422
Entry
Dmel_CG1422       CDS       T00030                                 

Gene name
p115
Definition
(RefSeq) p115, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Uso1_p115_head Arm_vescicular Uso1_p115_C Arm Cnd1 Rootletin ADIP bZIP_1
Other DBs
NCBI-GeneID: 31698
NCBI-ProteinID: NP_001284992
FlyBase: FBgn0040087
UniProt: Q9W3N6
Position
X
AA seq 836 aa
MEFLKSGIKTVLGSTEPGQQPSAAETVEKLVDRVYSSTLLEDRRDACRALKALSRKYRIE
VGAQGMPPLVQVLQNDGQDAEIISYALDTLCNVVTSEEFDEEADNPTVSVNVGEQFTEMF
IKTPEHVTLVMGYLDEYDFRVRRAAIQLITSLISNKTRELQDLILVSPMGVSKLMDLLTD
SREVIRNDVLLLLIELTKGNSNIQKIVAFENAFDRLFEIVREEGCSDGGIVVEDCLILLL
NLLKNNSSNQQFFKEGSYIQRLSPMFELSQDAEEVGWSPQKVSNFHCLLQVVRALVTPSN
QQQVVAACQRVMQKSRLLHALCEILMSSGVPADILTETINAVAEVVRGDRDNQDELGRVM
APSSPPRPAIVVLLMSMINEKQLLALRCAVLYCFECFLYRNADGQRAVVQTLLPSSASDV
SALSTGQLLCTGLFSTDALANWFSAVALMHSLVENVALKEELLRVLLATPGGQKPITLLE
QCTNLMQQERYRLQSKVGLLMLLSLWLAHCPGAVKALLETQGTMAYLTAQLCSNEHDERE
FLVQGMCAFLMGLCIQFNDNSLPGQKREDISQLIIKRIGQESFCSKLAEVSRHEAYSRAC
KQAQIRAKSAGELLLDFEYCKLYKGLEALIAKLVSGFDVDGIELTELTLSSEASALVSQY
KGIIRGMDAQIQALQQSSKELEQENAELKEKLGEEQSLKAQLLDQNTLLKAQLGASTGQV
QSAQGAEATPPNEEELNAARYQANMYFAENIRLTKELETLRQQLSAEKQSADAAQDSLAA
MQKDQEDLLELLADQEAKLTRYEEAGSTNTLPTSNVAPSVPAAGGGSPIPSGTASR
NT seq 2511 nt   +upstreamnt  +downstreamnt
atggagttcctgaagagtggcatcaaaacggtgctgggcagcacggagccgggtcagcag
ccgagtgccgccgagacggtggagaagctggtggaccgtgtctactcctcaacgctcctg
gaggatcgacgggatgcctgccgagcgctaaaagccctgtcccgcaagtaccgcatcgag
gtgggcgcacagggcatgcctccgctggtccaggtgctccagaacgacggacaggatgca
gagatcatcagctatgcgctggacacactgtgcaacgtggttactagcgaggagttcgac
gaggaggctgataatcccaccgtttcggtgaatgtgggcgagcagttcacggagatgttc
atcaagacaccggagcatgtaaccctggtaatgggctatctggacgaatacgattttcga
gtgcgtcgcgctgccatccaactgattacgtccctcatttcgaacaagacgcgggagctg
caggatttgattctggtcagtccgatgggcgtttccaagctgatggatctgctgacggac
agccgcgaagtgattcgcaacgatgtccttctgctgcttatcgaactgaccaagggcaac
tcaaacatccaaaagattgtggcctttgagaatgcctttgaccgcctttttgaaattgtc
cgtgaggagggctgttcggatggcggaattgttgtggaggattgcctaattctgctattg
aatcttctcaagaacaactccagtaatcagcagttctttaaggagggcagctatatccag
cgattgtcgccaatgtttgagctctcacaggatgcggaagaggttggctggtcgccacag
aaggtctcaaacttccattgtctgctgcaggtggtgcgggcactggtcacgcccagtaat
caacagcaggtggtggccgcctgccagcgggtcatgcaaaagtctcgactgctccatgct
ctttgcgagattctgatgagcagtggtgtccctgcggatatactcacggaaaccatcaat
gcagtggccgaagtggtgcgcggcgatcgggacaaccaggatgaattgggaagagttatg
gctccgagcagtccacccagacctgccatcgtggtccttcttatgtccatgatcaatgag
aaacaactgctggcactgcgttgcgccgtactctactgtttcgagtgctttctttatcgc
aatgccgatggccagcgggcggttgtacagaccctgctgccctccagtgcgtccgatgtg
agtgccctttcgacgggacaactcctttgcaccggactcttctccacagatgcgcttgcc
aactggttctccgctgtggccctaatgcactcactcgtagagaatgtcgccctaaaggag
gaactactgcgcgtactgctggccactcctggtggccaaaagcctatcacgctactcgag
cagtgcactaatctcatgcagcaggaacgctaccgtttgcaaagcaaggtgggtctgcta
atgctactcagcctgtggctggcgcattgtccaggtgcggtgaaggctttgctggaaacg
cagggcaccatggcctacctgaccgctcaactttgctccaacgagcacgatgaacgagag
ttccttgtccagggcatgtgcgcattcctaatgggcctgtgcatccagttcaatgacaac
tcgctgccggggcagaagcgcgaggacatcagtcagctgatcatcaagcgaattggccag
gagagcttctgtagcaaactagcagaagtgtcgcgacatgaggcctacagtcgggcatgc
aagcaggcccagatccgtgccaaatccgctggggaactactgcttgacttcgagtattgc
aagctgtacaagggactggaggcgttgattgccaagctggttagcggatttgatgtagat
ggcattgaactgaccgaactcacgttgagctcggaagcttctgcattggtttcccagtac
aaggggattatccgcggcatggatgcccagatccaagcactgcagcaatcctccaaagaa
ctggaacaggagaatgccgagctgaaggagaaacttggtgaggagcagtcgctcaaggcg
cagctcttggaccagaacacgctgcttaaggcacagctgggagcctcgaccggtcaggtg
cagtccgcccaaggtgcggaagccacgccgcccaacgaggaggagctaaatgccgctcgc
taccaggccaacatgtactttgccgaaaacattcgtctaactaaggagctggagacacta
cgtcagcagttatcagccgaaaaacagagtgcagatgcggcgcaagattccctggcggcg
atgcaaaaggatcaagaagatttgctcgaactgctggccgatcaggaggcaaagctaacg
cgatacgaagaagcgggctcgactaatacccttccgacttccaatgtagctccaagcgtg
ccggcagctggcggaggaagccccatcccaagtggcaccgccagcaggtag

DBGET integrated database retrieval system