KEGG   Drosophila melanogaster (fruit fly): Dmel_CG14226
Entry
Dmel_CG14226      CDS       T00030                                 

Gene name
dome
Definition
(RefSeq) domeless
  KO
K19599  cytokine receptor domeless
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: fn3 DUF3915 SKG6
Other DBs
NCBI-GeneID: 32976
NCBI-ProteinID: NP_523412
FlyBase: FBgn0043903
UniProt: Q9VWE0
Position
X
AA seq 1282 aa
MVAQEQLVLLLMLLAGCRGGANAILDPGWVIPSKVEQLIGGDFNLSCTLNEDYFNGKSAE
DCPVEKLYFTGGGRVYRDSKHIRILNNTTILFSDTNAVEQENDYHCMCDEYVINKSKVYV
GTRPLLVRDFNCLDYDFQFMVCNFTQPPNTVITKYNISYNTNNDWRYSNTLDCNFDSAPV
VTCNLTDDNYKRFSETFYFRLSISNALGHETQPITINHFERLVPARPGQNLTLLNRTESS
VCLSWEMPRRSNYNRGLVWQVRVTPQNFEPITRPSWRNHTLTIKDTLCLTELPFAGYNYT
LRVRVRANQNNTLWSEPMIYAFATAPAPPRRPPRVTYGSFYVYSSEKAMRFYWEPLEEHE
LNGPDFRYSISEYRINGTAVDPGLIKVESNSAMIDHWSMSAVHHFLIRSSNSQGLSVNAT
PMTIGPISNRDFKVREPRNIRSVYHPTNKSYTLSWDPPSDQRELQNYTVFWCVPKPGLQS
ECEGSIRFAEVASGLHHFTTSPDQLLTLHMAVSANYQSHNTGLHWAICSSDKKDDLAKME
PSIDVATSTSLTVSWSERVCAVILAGYNLTYCQRSAGRPDNCTTVTIDRYTNKHVIQNLV
PYTDYSVKMLMYSDSRVSKYSDELVNRTGEAAPSQPRELQLIRVTSDSVELAWKPPLLAN
GVVRAYEGTFRSLHDNVTDTFRVSASADELVNNEKPITYRLGNLTAFTKYEISVRARTVY
PSEPSNVILFSTAIGVPSPPQLYVINNPDQSSRLDWEPPRTPAGRIDFYEISLRDNNASC
LTSTILPGRNLSYVMATPRCTSHNPFQLAVRAINVEQHPQLNGADAAEGAVLLMSTNGKG
CEARTDALGEEERLQFEAYAANMTAYRLYRSDWGIYGFICTPDTHSVKAMYQTIEVTVAI
LVLGVIFYLVYKKYRKMSDIGLVLPQGIMETMKKPIDMGGLGLGLGPDSSVSGGIVCTRV
DDSPPYTPQDLPHDFSSCGSESSKLLLRTASSSGGGGCVDRDGYDDNHETGPISAVGPPT
SYLAMRHGLLVQNDRERERERDREQEREREQQQQQRESEMDREQSCTNGYIKPTQMKSWG
GNGPSDNDHTFSVPSTAMTAPMSQPLSQIPLSGYVPVPIPQSRFNPAPVQPFGSPAVPSA
ATAAAASTFFPPAHLLNMDNYVQASDLHKLKPLVAAPLSQTGGPAFAGSSPATSPPLQLP
PVHAASPAAATPKMADIGYTTMEQLQLTGLIKPPLAATVGSPTHAAGGAPGGGNQHSRLQ
PQINGYVTPQDLNAMAHNRHVL
NT seq 3849 nt   +upstreamnt  +downstreamnt
atggtggcccaggagcagctcgtcctgctgctcatgctgcttgccggctgccggggtggc
gccaacgccatcttggatcctggctgggtgattccctccaaggtggagcagctcatcggc
ggcgactttaatctgagctgcaccctcaacgaagactactttaacggcaagagcgccgag
gactgcccggtggagaagctgtactttacaggcggcggccgcgtctaccgcgattccaag
cacatccgaatcctgaacaacaccaccatcctgtttagcgacacgaatgccgtggagcaa
gagaacgactaccactgcatgtgcgacgagtatgtgatcaacaagtcaaaggtctacgtg
ggcaccaggccgctcctggtgcgcgacttcaactgcctggactacgacttccagtttatg
gtgtgcaacttcacccagccgcccaacacggtcatcaccaagtacaacatcagctacaac
accaacaacgactggcgatatagcaacacactggactgcaacttcgactcggcgccagtg
gtcacctgtaacctaaccgacgacaactacaagcgcttcagcgagaccttctacttccga
ctgtccatctccaatgccctgggccacgagacgcagccgatcacgatcaatcactttgag
cgtctggtgccggcgcgacctggccagaacctgaccctgctcaacaggaccgagagctcc
gtgtgcctgtcgtgggagatgccccgtcggtccaactacaatcgcggcctggtgtggcag
gtgcgcgtcacgccgcaaaactttgagcccatcacgcggcccagctggcgaaaccacacg
ctgaccatcaaggacacgctctgcctcacggagctgcccttcgccggctacaactacacg
ctccgggtgcgcgtgcgcgccaaccaaaacaacacgctctggagcgagcccatgatttat
gcgttcgccaccgctccggcgccgccgcgccgccctcctcgcgtcacctacggcagcttc
tatgtctactcgtcggagaaggctatgcgcttctactgggagcccctggaggagcacgag
ctgaacggaccggactttcggtactccatcagcgagtaccgcatcaacggaacagcagtg
gatcctggcctcatcaaggtggagtccaactcggcgatgatcgatcactggagcatgagt
gccgtccatcacttcctcatccgcagcagcaatagccagggtctgtctgtgaacgccact
ccgatgacgatcggccccattagcaatcgggacttcaaggtgcgcgagcccaggaacata
cgcagcgtctatcatccgaccaacaagagctacacgctcagctgggatccgccgagcgat
cagcgggaactgcagaactacaccgttttctggtgcgtgcccaagccgggcctgcagtcg
gaatgcgagggttcgatacgcttcgcggaggtcgcaagcggtctgcatcacttcaccacg
tcaccggaccaactgctcacgctgcacatggccgtgtcggccaactaccaatcgcataat
acgggcctacactgggcgatctgcagtagcgacaagaaggacgatttggccaagatggag
ccgtcgatcgatgtggccaccagcacctcactgacggtcagttggtcggagcgcgtctgc
gcagtgatcctggccggctataatctgacctactgccagcgctcggccggccgtccggac
aattgcacgacggtgaccatcgatcgctatacgaacaagcacgtcatccagaatctggtg
ccctacacggactacagtgtcaagatgctgatgtattcggactcgcgggtcagcaagtac
agcgacgagctggtcaaccgcaccggagaggcggcgcctagccagccgcgggagttgcag
ctaatccgcgtgaccagcgacagcgtggagctcgcctggaagccaccgctgctggccaac
ggcgtggtgcgcgcctacgagggcaccttccgctcgctacatgacaacgtgaccgataca
ttccgcgtaagcgcctccgccgacgagctggtgaacaacgagaagcccatcacctaccgg
ctgggcaatctcaccgcattcaccaagtacgagattagcgtgcgtgcgcggaccgtctat
ccatcggagcccagcaatgtgatcctcttcagcacggccatcggagttccctcgccgcca
caactgtacgtgatcaacaatccggatcagagctcacgtctcgactgggaaccgccaagg
acgccggccggacgcattgatttctacgagatctcgctgcgcgacaacaacgccagctgc
ctgacaagcaccattctgccgggcaggaacctatcctatgtgatggccacgccgcgctgc
accagccacaatcccttccagctagcggtgcgtgccatcaacgtggagcagcatccgcag
ttgaacggagcggatgcagcggaaggtgccgttttgcttatgtcgaccaacggcaaggga
tgcgaggcacgcaccgatgcgctcggcgaagaggagcggctgcagttcgaggcctacgct
gccaacatgaccgcctaccggctctacagatccgattggggcatctacggattcatctgt
acaccggacacgcacagcgtgaaggccatgtaccagaccattgaggtgaccgtggcgatt
ctcgtgctgggcgtcatcttctacctcgtgtacaagaaataccgcaagatgtccgatatc
ggtctagtgctgccgcagggaatcatggagaccatgaagaagcccatagacatgggtggc
ctgggattgggcctgggtccagactcgtccgtcagcggaggcatcgtgtgcacacgggtg
gacgactcgccgccatacacgccgcaggatctgccgcacgacttcagtagctgcggcagt
gagagctcgaaactgctgctgcgcacagcgtcctcctctggtggcggcggctgcgtggat
cgcgatggatacgatgacaatcacgagacagggccaattagcgcagttggtccgcccacc
agctacctggccatgcggcatggccttctcgtccagaacgacagggagcgcgagagggag
agggatcgtgagcaggagagggagcgggagcagcagcaacagcagcgcgagagcgaaatg
gatcgggagcagagttgcaccaatggttacatcaagcccacacagatgaagagctggggc
ggcaacggtccctcggataatgatcacacgttctcagttccttcgactgcaatgaccgct
ccgatgtcccagccgctgtcccagattccgctcagcggctacgtgcccgttcccattcca
caatctcggttcaatccggctccagttcaaccgtttgggtcgccagcagtaccttccgcc
gccaccgcagccgctgcgtcgacctttttcccaccggcccacttgctcaacatggacaac
tacgtgcaggcctcggatctgcacaagctgaagccgctcgtcgcagctccgttgtcgcaa
accggaggaccagcctttgcgggatcttcgccagcaacttcgccaccgctacagctaccg
ccggttcacgccgcaagtccagctgccgccacgcccaaaatggctgacatcggctatacc
accatggagcagttgcagctcactgggctgataaagccacctctggccgccaccgtggga
tcgccgacgcacgccgctggtggggcgccgggaggcggcaaccagcactctcgcctccag
ccgcaaatcaatggctacgtaacgccgcaggatctgaacgccatggcccacaatcggcac
gtcctctaa

DBGET integrated database retrieval system