KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1438
Entry
Dmel_CG1438       CDS       T00030                                 

Gene name
Cyp4c3
Definition
(RefSeq) cytochrome P450-4c3
  KO
K15001  cytochrome P450 family 4 [EC:1.14.-.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dme00199]
    Dmel_CG1438 (Cyp4c3)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-  Acting on paired donors, with incorporation or reduction of molecular oxygen
    1.14.-.-  
     Dmel_CG1438 (Cyp4c3)
Cytochrome P450 [BR:dme00199]
 Cytochrome P450, animal type
  CYP4 family
   Dmel_CG1438 (Cyp4c3)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 43663
NCBI-ProteinID: NP_524598
FlyBase: FBgn0015032
UniProt: Q9VA27
Position
3R
AA seq 535 aa
MSSKVITSLMAESILLSKVGQVISGYSPITVFLLGSILIFLVVYNKRRSRLVKYIEKIPG
PAAMPFLGNAIEMNVDHDELFNRVIGMQKLWGTRIGINRVWQGTAPRVLLFEPETVEPIL
NSQKFVNKSHDYDYLHPWLGEGLLTSTDRKWHSRRKILTPAFHFKILDDFIDVFNEQSAV
LARKLAVEVGSEAFNLFPYVTLCTLDIVCETAMGRRIYAQSNSESEYVKAVYGIGSIVQS
RQAKIWLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPD
AYDDVGKKKRLAFLDLLIDASKEGTVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGC
HPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDV
NIGGKIVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRN
CIGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGLRVKITPRD
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgtcctcgaaagtgataacctcgttaatggccgagagcatactgctctcaaaagtgggc
caagtgatatccggctactcgccgatcacggtttttctccttggatccattctaattttc
ctcgtagtctacaacaagcgccgatcccgactggtgaagtacatcgaaaagatcccggga
cctgcggccatgcccttcctgggcaacgccatcgaaatgaatgtggatcacgacgagctc
tttaaccgcgtcatcggcatgcaaaagttgtggggcacgcgtatcggaatcaatcgcgtt
tggcagggaacagctccaagggtgctcctcttcgagcctgagaccgtggagcccatactg
aacagccagaagtttgtgaacaagagccacgactacgactatctgcatccttggttggga
gagggtctgcttaccagcacagatcgcaagtggcactcccgcaggaagatcctcacacct
gccttccacttcaaaatcttggacgatttcatcgacgttttcaatgagcagagcgcagtc
ttggccagaaaattggcggtggaggtgggcagcgaggcgttcaacctgttcccctacgtc
acgctctgcaccttggacattgtttgtgaaaccgccatgggtcgcagaatttacgcccag
agcaatagtgaatcggagtatgtgaaggcggtctatggcattggatcgattgtacagagt
cggcaggcgaagatttggctgcagagcgacttcattttcagcctgaccgcggagtacaag
ctccaccagagctacataaacaccctgcatggattttccaacatggtgatccgcgagcga
aaggctgagttggccattctccaggagaacaataacaacaataataataacgcccccgat
gcctatgatgacgtgggaaagaagaagcgcctggccttcctggaccttctcatcgatgcc
tctaaggaaggaactgttctttctaatgaggacattcgcgaggaggtagacacctttatg
ttcgagggccacgacaccacctctgcggccatttcctggacactatttttgctgggctgc
cacccagagtaccaggagcgcgtggtggaggaactggactctatcttcggcgatgacaag
gagacgccggccaccatgaagaaccttatggatatgcgatacctggagtgctgcatcaag
gactcgctgcgcctgtttcccagtgtcccaatgatggctaggatggtgggcgaggatgtg
aacattggtggaaaaatcgtgcccgccggaactcaggccatcattatgacctacgccctg
caccgcaatccgcgcgtcttccccaagccggagcagttcaatccggacaatttcctgccg
gaaaactgcgccggacgccatcccttcgcctatataccctttagcgcaggaccgcgtaac
tgcattggccagaagttcgccattctggaggagaaggccgtgatttccacggttttgagg
aagtacaaaatcgaggctgtggatcgccgggaggatctcacgctgctgggcgagctcatt
ctgcggcccaaggacggcctacgggttaagattactccaagggattaa

DBGET integrated database retrieval system