KEGG   Drosophila melanogaster (fruit fly): Dmel_CG14444Help
Entry
Dmel_CG14444      CDS       T00030                                 

Gene name
APC7
Definition
(RefSeq) anaphase promoting complex subunit 7, isoform A
  KO
K03354  anaphase-promoting complex subunit 7
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmel_CG14444 (APC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG14444 (APC7)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG14444 (APC7)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     Dmel_CG14444 (APC7)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    Dmel_CG14444 (APC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_19 ANAPC3 TPR_16 TPR_14 TPR_2 TPR_1 TPR_8 Fis1_TPR_C PknG_TPR DUF1768 TPR_9
Motif
Other DBs
NCBI-GeneID: 31594
NCBI-ProteinID: NP_572329
FlyBase: FBgn0029879
UniProt: Q9W3Y6
Position
X
AA seq 615 aa AA seqDB search
MASFLIVVEKMEIALFANAKKLYDHKLYECVIPAADLLRTVLKNDRYVATLDVEYQVLLY
LLNANYKERNYRAALRHFDEIIHKRRLMMRHKNAVLVAIESSYPEFGDAEQRRRAAECYR
QIGNTDMAIETLLQVPPTLRSPRINLMLARLQHHGSRHGTTKKSEAVLAYKEVIRECPMA
LQVIEALLELGVNGNEINSLVMHAATVPDHFDWLSKWIKALAQMFNFKHSDASQTFLMLH
DNTTLRCNEHLMMALGKCLYYNGDYFQAEDIFSSTLCANPDNVEAIGLMAVLCGQEGGCE
QDSADMDYLFAKVSSEVKYTASHWFAHAQLLYDEGKFERGLNFVEKCLDSEPRNHEALIL
RGRLLIALERHTQAVCAFRTAQMVAPYRFEIYRGLFHSYLAQKRFKEANALCNWTIRLFQ
NSPRSFTMFGRTLFLFPDPRMRRTARKFAEKSLKINHIYTPAVNLIADICQVEGPTKAII
KLLEKHVIIFPKVNLLNHLGDIMRKQKEPVKAMEYYYKALRQDPKSKRTLRGLRLLAKSD
DESPVLDESDDIGMDNQQSINDLTTLCEATNAQGAEGAESVENSREASSSAAARSGQEED
VDEHDWIDVPDGMSY
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggcatcatttttgatagtcgtggaaaagatggagatcgcgctattcgcgaatgctaaa
aagctttacgatcacaagctttacgagtgcgttattccagcggcggatctgctgagaacc
gtgcttaagaatgatcgctatgtggccacactggatgtggaataccaggtgctgctctat
ctgctcaatgcaaactacaaggaacgaaattatcgcgcagctctaaggcatttcgacgag
atcatccataagcggcgactaatgatgcgccacaagaatgccgtcttggtggccatcgaa
agttcctatccggaattcggagacgcggagcagcgtcgccgtgctgccgagtgttatcgt
caaattgggaataccgacatggccatagagacattgcttcaggtgccaccaacattgcga
tcgccgagaatcaatctgatgctggccagactgcagcatcatggcagcagacatggaacc
accaaaaaatcggaggccgtgctcgcctacaaggaagtgatccgcgagtgcccaatggcg
ctgcaggtgatcgaggcgcttttggaactgggagtcaatggcaatgagattaactcgctg
gtgatgcacgctgccacggtgcccgatcactttgactggctgagcaagtggatcaaggct
ctcgcccaaatgttcaacttcaagcactcggacgcatcgcagaccttcctcatgctgcat
gacaacaccacgttgcgatgcaatgagcacctaatgatggcactgggcaagtgcctctac
tacaacggcgattactttcaagcggaggatatcttctcgtcgacgctgtgtgccaatccg
gacaacgtcgaggcgatcggactgatggcggtgctatgtggtcaggagggcggttgtgag
caggacagtgcggatatggattacctattcgcaaaggtgtcctccgaagtgaaatacacg
gccagccattggtttgcgcatgcccagctgttgtacgatgagggaaaattcgagcggggc
ttgaatttcgtagaaaaatgcctggattcggagccgcgtaaccatgaagccctaatcctg
cgcggacgtctgttaatcgcgctggagcggcacacgcaggcggtgtgtgcctttcgcaca
gcacaaatggtggcaccgtatcgtttcgagatctacaggggactcttccacagctatttg
gctcagaagcgattcaaggaggccaatgccttgtgcaactggacgatacgcctctttcaa
aattcgccaaggagcttcacgatgtttggtcgcacgctctttcttttcccggatccaagg
atgagaaggactgcgcggaagtttgccgaaaagtcactgaaaatcaatcatatctacacg
ccggcggtgaatctaattgccgatatctgtcaagtcgaaggtccgaccaaggccatcata
aaactgctcgagaaacacgttattatcttcccgaaggtgaatctgctcaaccatctcggc
gatataatgcgaaagcaaaaggaacccgtcaaggcgatggaatactattacaaggcattg
cgtcaagatcccaaaagtaagcgcactttgcgaggactacgtttattggcgaaatccgac
gatgaatcacctgtcctggacgaaagtgacgacattgggatggataatcagcaatccatc
aatgacctgaccacgctctgtgaagcaacaaatgcccagggtgccgagggtgctgagagt
gtggagaattctcgagaggcatcctcctcagcagccgcaaggtcaggtcaggaggaagat
gtagatgagcacgattggatcgacgtgccagacggcatgtcgtattag

DBGET integrated database retrieval system