KEGG   Drosophila melanogaster (fruit fly): Dmel_CG14472Help
Entry
Dmel_CG14472      CDS       T00030                                 

Gene name
poe
Definition
(RefSeq) purity of essence, isoform B
  KO
K10691  E3 ubiquitin-protein ligase UBR4 [EC:2.3.2.27]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG14472 (poe)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     Dmel_CG14472 (poe)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   UBR box proteins
    Dmel_CG14472 (poe)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E3_UbLigase_R4 zf-UBR
Motif
Other DBs
NCBI-GeneID: 46243
NCBI-ProteinID: NP_001260222
FlyBase: FBgn0011230
UniProt: Q9VLT5 M9PB68
Position
2L
AA seq 5322 aa AA seqDB search
MSAHSGGTDWNSVVKALILNRTGALNKNEVVNLLKAITRCEHDFFEEESNFTQFYTAFAA
LAADKLMQIKTICQTQICQLHDATAVLIRFIIYRLPRVSVYETKWLLGALKMLCEGRECP
ASASSSMFDYNAVANVLKSCKHPESTTKSIMPSSSSSGSGASNDKESPKSEIKRSRSDLS
SVILQQLIAPLEPGKMTWVPLSEEVTDCTEQILAANVEYFQEQNGVDTLLDVCVSLPILN
RYRSKYMETINGGKSLYLPLTQVEATAVKSSMNHMLTDLTILSQAQALIEMQPLTPSRIE
RLSMCGIAALYNAVLTSIATSVLGMSQASSSQKQTASTSQGSGVGGSSGGQSNKDHDDFE
DQACSIVNKALEIYSNIGHMFKTSARIHVYQNHLCYGSWLLISGIQGAMGASGSGGSSSD
SASKSASKATKSGSEAGTAPTTPIARVNLFKVQQGFGELNAAIANHSIKLLSELIEDLKV
EAACGQSLESTELPEPAQFDILQNYSSLERIVRVLNTATLHQLFTFLATVAYRKACTLKR
ASAKDRTECEPISYSDSTTYFNDSLSCSDNSEEDDSESYLGHWFKETLSPETHDDNANTS
TQERAEQKSALVPKLDEPHEYLDLAADIFCFLDQFLANRHAYMQRYVKAGVSDQQMLLMA
NIIKDFDRDVMRNESDQGSGNAPAASAGAGTSAGASTKWQTSMIRFSGAAGRYIHNLIST
SLLSEQLQSNLLQHLSISPWSTDTNTWPLQVYPSTLSVLVQILLLKPTQEKEAACLSVWH
RLINTLVEGVCSSNTASDSDYEDLNIEHAQLLLFLFHSLNLMQKKSILLLTAGGVIRCAE
VCRGISEDRPVKNSQIMLLSRLLLFLEYLMKHLYNAPPELLDQVRWNLFSVSSMPDTQKI
TDLLNCRTKLNSYCRHDIEENFRKSAGEYGSSIRPTFYSLVMGDPEISYWAQEFKLDGLA
WNFILCTPDKLKYPLLVDALTDILSITDMSMYSKEKDKEASMHNLCAIQYCFTIAWKLNL
GLPPSTSHVESLKAERSPNLHSLMWSIRLPLASSHYLVVSSLIKQGMYTQYAETLWTHVG
DIGADIKYSLKQTILGVEAFNSQMNGNGTPRLSDLILFDSLVAHMQAVAWANKEGLKWPR
KESEDAAGEQSAGTSLTSSSNDPELYSSNESIDDQKLKQDDDGKLSSDLQKYNQLVNELM
VKLMNSYQLLSVIVRGQMLKQLSSSTPEKALNLIVPIVSDKPAIMLELHAAFLKLLPNED
KQLIANEWPKCLMVNDFAFNGKQHPVEPYILNVIDAHIIELTRGSNYSTLHTLKHCLKSI
LQLFELLLPHRTANAEVETQLKQLLISSMLDMRTDYLQGHSEHCLREILSGLTQEAQKLL
LYEHMVGYCYRMLKEFAADLRQPQSAGPSGGAPLDQDRAMFNESMLFAVLKTMFKMLEKP
VAVQAMRQFFKDQRSGSLTTLLLSFTGTSLPVSYARKMLQFVNRLFQLSLQADSQFQHED
LVECFSELATVDVARLKQWLGHIIYGPNVSTDVSTSEALDTTCRMLTSILQPSSSSSSNA
QTPTNMATVSAMPSISDQLDPMEIEYDCGTAAGGGESNPGTGGAAANTSQILSLWQAAQP
NPSEESSQACDHSDSERNGALLLSFVKSLVKDQSKASQIAPPLFQALLQLGQTLISPPQE
GCDFADVLQIMITLADASPARGHVALFNTTLLWLELAKLQLPDKHLKHAENVSAQLRYLS
ELLQSIGFRGSRQHNPPWDDELQTDIDELYDELAEEGEQDSLLDDSDEDTLNNKLCTFSQ
TQKEFMNQHWYHCHTCNMINTVGVCSVCARVCHKGHDVSYAKYGNFFCDCGAKEDGSCQA
LSRRIGSNEVRDSAGIGSYLPSHMSLLAGKKRSSLPVGQPVLTRKDSLTNERIAVLTKLL
EPYRETLQHQDQWLLVVRCILEYFDLLLPSINENCMLYSIVGCHKRATAALERLHLLEQS
FQVTDQLMFATLGSQEGAFENVRMNYSGDQGQTIKHLLSSGVVRRVAFCCLSSPHGRRQQ
LAVSHEKGKVTILQLSALLKQADASKRKLTLTQLSSAPIACTVISLAANPCNEDCLAVCG
LKECHILTFSSSGSTNEHIVVNPQLENGNYIKKAVWLPGSQTLLAVVTSDYVKIYDLAVD
TYSPKYYYLVAVGKIRDCTFVYQDGNYNMLTFASSGYIYTQQLDQQSLAVHGDFYVTNTL
ELSHQHIKDIAGHIGGGGVSIYYSHTLQLLFYSYSCGRSFFSPLTNVSEGVKGIYHLDTN
SASKSASKGPLQPLVQWTEVTGHPGLVYASMQTSNNPIILMITPERIYLQEIKAQSAKSR
IMDVVGIRHAVAGVEKTTLLLLCEDGSLRIFSAQPEYTSFWLSPQVQPFGNQLYSSTLMA
KGGGSGSTSKSKSNTASGKMTSRKASQQQKQPTAGGQPVFPIDFFEHCNMLADVEFGGND
LLQIYNKQKLKTRLFSTGMFVASTRSNGFTLEVINNDPNVVIVGIRVLIGTQDVQRAPQS
VTILGRTIPTPVRRARWFDIPLTREEMLQSDKLLKVVFAKAPDPEHVTLLDCIEVYGKSK
ELVGWPDESEDVTVPGSSAPAVSSSQASSANFGEGFNCITQLDRMANHLLEVMDCALHLL
GSGVPASMRQKAVKTASALLLLPTPNPVQTQARYVLATLYGTRALYHNYKDGVLLQFVNR
ELQSMQPKLEKLETLREIDPEAFYRLVLMVRGIANARPQSLAKICVENNYDIVPTLMGIV
LELHKVTPTLDEPVNIVKRGLCQPETIVHCLVEIMYGFALADPGQVGRMTKYFIDLLKHD
ASVISHSAKEALILLLSPRMKRRKVAIVTPPACSTPTPSTSTMQALQAAASSAASDIIEE
AAGVVVDGSVGGGGLPEPNADAEGAAVGVGGVGQQQMLNLEAFMGGGFPRLLGLPEDADD
EAIMDIAIALSLQQHGGDANALQSLQQGLANLQGIRQATAMAAAVNAAANVSLGGSDDDE
GSNVATDGSTLRTSPAEPAGSGGSESGGSGVESIGGTSARSSNFGDHANASPPRQGSTKD
DQEQPGPSGVAGSGGVAVLSAMSSSEDNEANEDDKLSKLHDLRIAVLESIIQHLGTFDLC
NGLQAIPLIQVILMLTTDLNGNNERDQQVLHDLLTALVDYVEIGKRGAAARMETKCPGNE
VRLALLSLFGVLMGKTKSKQTGTTSPPHQFKDNSSFVASTTANVLSKSGAFVYALEALNT
LLVHWKNVLGDPYAAGGGLASQSAQASGGASGPGVQLLKPIKHGPKPDISILIPHNYLKN
YPDIFESYDGLLTEIIVRLPYQILRLSSAHPDNYDSGFCEAMTFTLCEYMMLNLNTLLRR
QVRKLLMYICGSKEKFRMYRDGHSLDAHFRVVKRVCNIVSSKTGAPYNANPPMLSYDALV
ELTEHLRTCQEISQMRTGNWQKFCVVHEDALAMLMEIACYQLDDGVSPIIIQLLQAAVCN
LPPPSGSKQAQPQPSTSSASGKLRTDREKSEDTDAYYSKFDPAQCGTFVHQIFRYACDAL
IIRFVRIFLLENNITQLRWQAHSFMTGLFEHANERQREKLLNIFWNLWPLVPTYGRRTAQ
FVDLLGYLTLSTRSITERLPEFVSRAVDVLRQQNELLCKHPNAPIYTTLESILQVNGYYL
ESEPCLVCNNPEVPMANIKLPSVKSDSKYTTTTMIYKLVQCHTISKLIVRIADLKRTKMV
RTINVYYNNRSVQAVVELKNRPALWHKARSVSLQSAQTELKIDFPLPITACNLMIEFADF
FETVSGSSENLQCPRCSAAVPAYPGVCGNCGENVFQCHKCRAINYDEKDPFLCHSCGFCK
YAKFDFSMYARVCCAVDPIESAEDRVKTVSLIHSSLERADRNYRQLLTNKQMLELLIQKV
AEHRSSDRMVEDNMASVHSTSQVNKIIQLLAQKYCVESRTSFEELSKIVQKVKACRSELV
AYDRQQQDQPPVNPGSTTGAENPTTNRCYGCALASTEQCLTLLRAMAYNYDCRVCLYSQG
LVSELAEHNLRRGTPLIQEEVRNLLVVLTKDNAEACMHLLQLVTTRVKNALMGSIPLISL
EAAVHQEMTLLEVLLGQDDICWEYKLKVIFELFISNCRLPRGPVTAVLHPCLRIMQNLIC
PVLPGSKPNQKVATTDLCSMKMFEGNTVDYRAWLNSDRNHEYAAWSKRMPSNNQAKLKNA
KDQNVAASGGSDAPPKSRREVRVAFLSEKYGKRWRERVLDKQRVIKPLVFNAKWIQPLLF
NANSRFGRQLACSLLSSLSRTNERRQQALNMLTSFLKHVGEAGEASAEYLMLYKNMATEQ
PWLQYLVLKGVLSQISQLLAIEISKVHRMEEYSLSSDLSLGYALRQYVELLWLLLECPNI
RRTYKTRMLGPVLESYLALRSLVVQRTRLIDDAQEKLLEMLEDMTSGTEEETRAFMEILI
DTVEKTRMNDIKTPVFVFERLYSIIHPEEHDESEFYMTLEKDPQQEDFLQGRMLGNPYPS
SEMGLGPLMRDVKNKICTDCELIALLEDDNGMELLVNNKIISLDLPVKDVYKKVWLAEGG
DRDAMRIVYRMRGLLGDATEEFVETLNNKSQEQVDTEQLYRMANVLADCNGLRVMLERIG
SLQRISRNRELIQVLLKLFLICVKVRRCQEVLCQPEIGAINTLLKVLQMCLQSENDSIQS
AVTEQLLEIMETILSKAASDTLDSFLQFSLTFGGPEYVSALISCTDCPNVRNNPSVLRHL
IRVLAALVYGNEVKMALLCEHFKDTLNFNRFDNERTPEEEFKLELFCVLTNQIEHNCIGG
TLKDYIVSLGIVERSLAYITEHAPCVKPTLLRTDSDELKEFISRPSLKYILRFLTGLSNH
HEATQVAISKDIIPIIHRLEQVSSDEHVGSLAENLLEALSTDSATAARVQQVRDFTRAEK
KRLAMATREKQLDALGMRTNEKGQVTAKGSILQKIEKLRDETGLTCFICREGYACQPDKV
LGIYTFTKRCNVEEFELKSRKTIGYTTVTHFNVVHVDCHTSAIRLTRGRDEWERASLQNA
NTRCNGLLPLWGPAVGEAAFSACMTRHSSYMQESTQRCDISYTSSVHDLKLLLVRFAWER
SFHDDAGGGGPQSNMHFVPYLLFYSVYLLLSSRSAARDSKTLLTYLQAPPSEKWLECGYE
VDGPLFMATISLSLHSRELWNKHKLAHLKRMIAVAQGRHVSPAVLCKALLAPADRQVKDY
TVYKPFLMMWALVDLIYDNLFKTVSTPKEEDWPISLFDYLRKNDEALLKSTDSILQTLTE
EFLPCTSFVEFCDVAGLLHLIEHPDNFIEEILAALPSTSSSN
NT seq 15969 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcccacagcggcggaacggattggaattccgttgttaaagccctgatacttaac
cgtacaggagccttaaacaagaacgaagttgttaatttgctcaaagctatcacgcgatgc
gaacatgactttttcgaggaggaaagcaatttcacgcagttttacacggcctttgcggcc
ctggcggcggacaaacttatgcaaatcaagacaatttgccagacgcagatttgtcagttg
cacgatgccaccgccgtgcttatccggtttattatctatagactgcccagggtgtccgtc
tacgagaccaagtggctcctgggcgccctcaagatgctctgcgagggccgggagtgccca
gcatcagcgtcgtcatccatgttcgactacaatgcggtggctaatgttcttaaaagctgc
aaacatcccgagtcgaccaccaagagcattatgcccagcagcagttcctccggaagtggg
gccagcaacgacaaggagtcgcccaagtcggagattaagcgatcccggtcggacctgtcc
tcggttattctgcagcaactgattgctcctttagagcccggcaagatgacttgggttcca
ctcagcgaggaggtcaccgactgcactgaacaaatcctggcggccaatgtggagtacttc
caggagcaaaacggagtggataccctgctggatgtgtgtgtgagcctgcccatactcaat
cgataccgatccaaatatatggagaccatcaacggcggtaaatcgctttatttgccactg
acccaagtggaggccactgcagtgaaatcgagcatgaatcacatgcttactgatctgact
attttgagtcaggcccaagccctgatcgagatgcagccactgactcccagtagaattgaa
cgactatcaatgtgtggtattgctgcgctatacaatgctgtgttgacctcaatagccacc
agtgttctcggtatgagccaggccagcagctctcagaaacagactgcatccactagtcaa
ggaagcggagtaggaggttctagtggtgggcaatccaacaaagaccatgacgactttgag
gatcaggcctgtagcatagtgaacaaagctttagagatctactccaatattggtcacatg
ttcaaaacttcggccaggattcatgtatatcagaaccatctctgctatggcagctggctg
ctaattagcggtatacaaggagcaatgggcgcctctggaagcggtggatctagctcggat
tcggcatcgaagtcggcgtcaaaagcgaccaagtctggtagtgaggctggaaccgcacct
actacacctattgccagagtcaaccttttcaaggtacagcaaggatttggagaactcaat
gcagctattgctaaccacagcattaaattgctctcagagctaatagaagatctaaaggtt
gaagccgcatgcggacagagtctcgaatccacagagctcccggagcctgcacagttcgat
attttgcagaactacagttcgctggagcggattgtccgcgtgctgaatacagccactctg
catcaacttttcacttttctagccactgtggcttatcgcaaggcatgcaccttaaagcgc
gcttccgccaaggatcgtacggaatgcgaacccataagctactcagattctacgacttat
ttcaacgattctctctcctgttcggacaactccgaggaggacgatagtgagagttacctg
ggccactggtttaaggaaactctttctccagaaacccatgatgataatgcaaacacatcc
acacaagagcgtgctgaacagaagagcgcccttgtccccaagctagatgagccacatgag
tatttagacttggccgcagacatattctgtttcctggatcaatttttggccaatcgacat
gcctacatgcagcgctatgtaaaggcaggcgttagtgatcagcaaatgctgttaatggca
aatataatcaaagattttgaccgcgacgtgatgcgaaatgagagcgatcaggggtcggga
aatgccccagctgccagtgcaggagcaggaacctctgcaggagcttctaccaagtggcag
acgtcgatgattcgattttcgggagctgcaggccgatatattcacaatttgatttccact
tcattgctgtccgagcaattgcagtcaaatctgctgcagcacttgtctatatcgccatgg
tctactgatacaaacacctggcctttacaagtttatccgagtactctgtctgtactggtg
caaattcttttgctgaagccaacacaagagaaggaagccgcctgcctgtccgtgtggcac
cgccttattaacacgttggtggaaggagtttgttcttcgaataccgccagtgattctgac
tatgaagaccttaacattgagcacgcccaactgctgcttttcctatttcattcgctcaat
ctgatgcaaaagaaatccattctgcttttaacggctggcggtgttatccgttgcgcagaa
gtttgtcgtggaatcagcgaggatagacccgtaaaaaacagccaaattatgctgctgtct
cgcttgctgctctttttggagtatcttatgaagcacttgtacaatgcgcctccggaattg
ctagaccaggtgcgctggaatctttttagtgtgagcagcatgccggacacccaaaagatc
acggatctgctaaactgccgaaccaaactgaattcctattgccgccatgatattgaagag
aatttccgcaagtcggccggcgaatatggctcatcaattcgcccaactttttactctctg
gtaatgggtgatcccgagatatcctactgggctcaggaatttaagctggatggtttggct
tggaactttattctctgcacaccggataagcttaaatatccgctactggtggatgcattg
actgacatactatccatcaccgacatgtcaatgtattccaaggaaaaggacaaggaagcg
agcatgcataatctttgcgctatacagtattgctttacgattgcctggaagctgaatttg
ggtttgccgccctctacttctcacgtagagtcgctgaaggcagagcgatcacccaatctg
cactcactgatgtggagtatacgtctacccctggccagttctcactacctagtcgttagc
agcctaatcaagcagggaatgtatacccagtacgctgagacgttgtggactcatgtgggc
gacataggtgccgatataaaatatagtctcaagcaaacaattcttggtgtggaggcgttc
aatagtcaaatgaatggaaatggaactccccgcctctccgatctcatcctttttgattct
ttggtggcgcacatgcaggcggtagcctgggcaaacaaggagggcctcaagtggccgcga
aaagagagcgaagatgccgctggcgagcagtccgctggtacatccttaacttcatcgtca
aacgatccggaactttattcttccaacgaatcaattgatgatcaaaaattgaaacaagac
gacgacggtaagctgtcaagtgatttgcaaaagtataatcaacttgtaaacgagctaatg
gtaaagctcatgaattcttaccaattgctttcggtgatcgtgcgtggccaaatgctaaag
cagttgtcaagttcaacaccggagaaggcactgaatttgattgtgcccattgtaagcgat
aagccagcaattatgttagaactccatgcagcttttctaaaactcctgcccaacgaggac
aaacaactaatagcaaacgaatggccaaagtgcctaatggtcaatgattttgcattcaat
ggaaagcaacatccggtggaaccatatattttgaacgttattgatgctcacattattgag
ctgacacgaggatccaattactctaccctgcacactctgaaacactgcttaaagtctatc
ctgcaattgtttgagttgctgctaccacatcgcaccgcgaacgcagaagtagagactcag
ctaaagcaattgcttatctcctcaatgctggacatgcgaacggattacttgcaaggacac
agcgagcattgtctgcgcgagatcctcagtggtctgacacaagaggcacaaaagctgctg
ctttacgagcacatggttggatattgctatcgcatgctcaaagagtttgctgccgatctt
cgtcagccccagtctgcggggcctagtggcggagctcctcttgatcaggatcgtgctatg
tttaacgagtccatgctgtttgccgtgcttaaaactatgttcaaaatgctggaaaagccg
gtggcagttcaggccatgcgccagtttttcaaagatcagcgctctgggagtcttaccaca
cttttgctatcgttcactggcaccagtctgcctgttagctatgcgcgcaagatgctgcaa
tttgttaaccgacttttccagctatccttacaagcggattcacagttccagcatgaagat
ctggttgagtgtttctcggaactggccacagttgacgtagctcgtttaaagcaatggttg
ggccacattatctacggccctaatgtgagtaccgatgtaagcacctccgaggcattagac
accacctgccggatgctcaccagcattttgcagccgtcgagtagctccagcagcaatgct
cagacgccaacaaatatggccaccgtttcggctatgccaagtatctcagaccagttggat
cccatggaaattgaatacgattgcggaactgcagcgggaggcggagaaagtaacccagga
accggaggagctgcagccaatacctcgcagattctgagtttgtggcaggctgcgcagcca
aatccgtcggaagaatcttcacaggcttgcgatcatagtgatagcgaacgaaatggcgcg
ttgctcttaagcttcgtgaagtcattggtgaaagatcaaagcaaagcatcgcagatagct
ccaccactgttccaagctttgcttcagctcggacaaacattaatttcaccaccccaggaa
ggctgcgattttgcagatgtactacagataatgattactctagctgacgccagtccagca
cgcggccatgtcgccttgttcaataccaccctcctttggctggaactggccaaattgcaa
ttaccggacaaacacttgaaacatgcagagaacgtaagtgcccagttgcgctatttaagc
gaacttcttcagagcattggcttccgaggcagtaggcaacataacccgccgtgggatgat
gaactacagaccgatattgatgagctatatgacgagctagccgaggaaggtgagcaagac
tcgttgcttgacgattccgacgaggacacgttgaacaacaagctgtgtaccttctcgcag
acccaaaaggagttcatgaaccaacattggtatcattgtcatacttgcaacatgataaac
acagttggcgtctgttctgtgtgcgcaagggtttgccataagggacatgatgtcagttac
gccaaatatggaaatttcttctgtgactgcggagccaaggaggacggatcctgtcaggca
ttgagtaggcgtatcggcagcaatgaggttagagattcagctggaattggcagctatcta
ccgtcccacatgagcttactcgctggaaagaagaggagcagcttaccagttggccagcca
gtacttacgcgaaaggattcattgactaatgaacggatcgcagtacttaccaaactgttg
gaaccttacagagagacacttcagcaccaggatcagtggctgctggtcgtaagatgcatc
ctagagtattttgacctgctgctaccatcaataaacgaaaattgtatgctatactccatt
gtcggctgccacaagagagcaactgcggccttggagagactccacctgcttgaacagagc
ttccaggtaaccgatcaactgatgtttgcaactttgggctcacaagagggagcttttgag
aatgttcgaatgaactattctggcgaccaaggtcagactataaagcacctactatcatcc
ggagttgtccgccgtgttgccttctgctgtttgtcctcgccacatggacgtcgtcaacag
ttggctgtatcccatgagaagggaaaggtgaccatcctccagctgtcggcactgttgaag
caagcagatgcctccaagagaaagttaactctaacgcaattgagttctgcacccattgcc
tgcacggttatctccctagctgctaatccgtgcaatgaggattgccttgcagtttgtggc
ctaaaagagtgtcacattctcaccttctcaagcagtggcagtactaacgaacacatagta
gtgaacccccaactggaaaatggaaactacatcaagaaagctgtgtggctgcctggctca
cagactcttcttgccgttgtaacttcggattatgtaaagatttacgatttggcagtggat
acatatagcccaaagtactattacctagtggccgttggcaaaattagagattgcacgttt
gtgtaccaggatggcaactacaatatgctgacctttgcaagcagcggatacatctatact
cagcagttggatcaacagagtctagcggttcatggagatttctatgtaaccaacactttg
gagctgagccaccaacatatcaaggatattgccggtcatatcggaggcggtggagtatcc
atctactattcgcataccctacagctgctcttctacagttattcttgcggaaggagcttc
ttttcaccactcaccaatgtaagtgaaggcgtgaagggaatatatcacctggacacaaat
tcggctagtaagtcagcttcgaagggaccactacagcctctcgtgcagtggacagaggtt
acagggcatccaggattggtttacgccagcatgcagacatcgaataatccgattatattg
atgataacccctgaacggatttacctgcaagagatcaaggcacaatcggccaagtcacga
atcatggacgttgttggcattcgtcatgcggttgccggagtggaaaaaactacgcttttg
ctcctctgcgaggatggaagcttgaggatcttttccgctcaaccagaatacactagcttc
tggctatcgccacaggttcagccatttggtaatcagttgtactcgtccaccttgatggct
aagggaggtggatctggttcgacttcaaagtccaaatcaaatacagcatctggaaagatg
accagcagaaaggcaagccaacaacagaagcaacccacagctggaggtcagcccgttttc
ccaattgactttttcgagcactgcaacatgctagccgatgtggaatttggaggcaacgat
ctgctccagatttacaacaaacaaaaactaaagacgcgtctgttctcaacgggaatgttt
gtggccagcacccgatcgaatggctttactctggaggtgatcaataatgatcccaatgtt
gtaatcgtgggaataagagtgttaattggaactcaggacgtacagcgtgctccccaatct
gtgactattctgggacgtactatacccacaccggtcaggagggcacgttggttcgatatc
cccctgacccgggaagaaatgctccagtccgacaagttattgaaagtcgtgtttgctaaa
gctccagatccggagcatgtgacattactggattgcattgaggtatatggaaaatcgaaa
gagctggtgggctggcccgacgaaagcgaggatgttactgtcccaggatccagtgcgcca
gcagtatcttcctcccaggcaagtagcgctaactttggagaaggattcaattgcattact
cagctggatcgaatggctaatcaccttttggaagtaatggattgtgcactgcatttgttg
ggatctggagtacctgcttctatgcgtcaaaaggcagttaaaacagcgagtgccctattg
ctactgccaacgcccaatcctgttcagacccaggcgcgctacgtgctggccactctatac
ggaactagagcattgtaccataactacaaggatggagtgcttcttcagtttgtaaataga
gaactacagtcaatgcagccgaagcttgaaaaacttgaaactctgcgggagatcgaccct
gaggctttctaccgcctagttctgatggtccgtggcattgccaacgcacgaccccaatcg
ctagcgaagatctgcgtggagaacaactatgatattgttccaaccctcatgggaattgtc
ttggagttgcataaggttacaccgacgctagacgaacccgtgaatattgtgaagcgaggc
ttgtgccagccggagaccattgtccattgtctggtagagataatgtacggatttgccttg
gccgatcccggacaggttggtcgcatgaccaagtacttcattgatttgctgaagcatgat
gctagcgtgattagccacagcgccaaagaggccctgatccttttgcttagtccaagaatg
aagcgcagaaaggtggccatagttacacccccagcatgttcaacaccgactccctcaacg
tctaccatgcaggcactgcaagcagcggcttcttcagctgcaagtgatatcatcgaggaa
gcagctggcgttgttgttgatgggtcagttggaggaggtggattacccgaaccgaatgcg
gacgcggaaggtgctgcagttggagtaggaggagtcggtcagcagcaaatgctcaatctg
gaggcattcatgggtggcggtttccctcgcttactcggcctacccgaagatgccgacgat
gaggccatcatggatattgccatcgcattgagtctccaacagcacggtggggatgcaaac
gccttgcagtctcttcagcaaggattggccaatcttcagggcatccgtcaagctactgcc
atggcagcagctgtgaacgcagctgccaatgtctccctaggtggatccgatgatgatgaa
ggttccaatgtggcaaccgatggatcaacattgcgtacttctccagcagagcctgctggc
agcggtggatcagagagtggaggcagtggagtagagagtattggtggaacatccgccagg
agcagcaactttggcgaccacgcgaatgcctcgccgccgcgtcagggatccaccaaggac
gatcaagagcagccaggtcccagtggcgttgctggctccggtggtgttgctgttttgagt
gccatgagcagcagtgaggataatgaagcaaacgaggacgataagctcagcaagctacat
gaccttagaattgctgtgctggagagcattatccaacatctaggaacattcgacttgtgc
aatggcctgcaggcaatcccactgatccaggttatactcatgttgactaccgatctcaat
ggaaacaacgaaagggatcaacaagtgcttcacgatctgcttactgctctagtggactat
gtggaaattggaaagcgaggagctgccgcaaggatggagacaaagtgtcctggcaatgag
gtgcgcctcgcattgctttccctgttcggagttctgatgggcaaaacaaagtcaaagcaa
actggaacaacatcgccgccgcatcaatttaaggacaatagctcctttgtggccagtacc
acagcaaatgttctcagtaagagtggagcattcgtttacgccctagaagcactaaacacg
ctactggtgcactggaagaatgtgctaggagatccttatgcagccggtggcggattagcc
tcacagtcggcacaagccagtggcggagcttcaggtcccggagttcagctactgaagccc
attaaacatggtcctaaacctgacatatccatacttataccgcacaactatctgaaaaac
tacccggatattttcgagtcctacgatggactcctaactgaaattatcgtgcgattgcca
tatcaaattctgcgcttaagtagcgcccatccggataactacgatagtggattctgcgaa
gcgatgacctttacactttgtgagtacatgatgctaaatttgaacacactgcttcgtcgg
caagtgcgaaagctcctgatgtacatttgcggcagcaaggaaaagttccgcatgtatcgc
gacggtcactccctcgacgctcatttccgggtggtcaagcgggtgtgcaacattgtcagc
agcaagactggtgctccttacaacgctaatcctcctatgctttcatacgatgcactggta
gagttgacggaacacctacgtacttgccaggagataagccaaatgcgcacgggcaactgg
cagaagttctgcgtcgtccatgaagatgcgttggccatgctgatggaaatcgcctgttat
cagttggatgatggcgtgtcgcctattattatacaattgctacaggcggccgtttgcaac
ttaccccctcctagtggatctaagcaggcccagccgcagccatcgacctcgtctgcctcc
ggaaaacttcgaacagatcgtgagaagagcgaggatacagacgcctactactccaagttt
gatccagcccagtgtggtacatttgtgcaccagatctttagatacgcatgcgatgcgctg
ataatcagatttgtgcgaatattcctgttggagaacaacattactcagctgagatggcag
gcccactcatttatgaccggactttttgagcatgccaatgaacggcagcgtgagaaactt
ctcaacatattttggaacctgtggccattggtgcccacctacggtcgtaggacagcgcag
tttgtcgacctattggggtatctaaccctaagtaccagaagtataacagaacgactgcca
gagttcgtttcccgcgctgtggatgttctcaggcagcagaacgaactgctttgcaagcat
ccaaatgccccaatatacaccaccttggagtctatacttcaagtaaatggttactaccta
gaatcggaaccttgtttagtgtgcaacaatccagaggtgccgatggctaatataaagttg
ccatcagttaaatcagactctaagtacaccacaaccacaatgatttataagctagtccaa
tgccatactatttccaagttgatcgtgcggattgccgacttaaagcggacaaagatggtg
agaaccattaatgtttactacaacaaccgcagtgtccaggcggtagtggagctaaaaaat
cgcccagctctgtggcacaaagctcgctcagtatccctgcaatcggcacagaccgaactg
aagatcgattttccactaccaatcaccgcatgcaatttgatgatcgagtttgctgatttc
tttgaaactgtgagtggatccagtgagaatttacaatgtccacgttgtagtgcagcagtg
ccggcttatccgggagtctgcggaaattgcggtgagaacgtgttccagtgccacaaatgt
cgggccattaactacgatgagaaggacccgttcctgtgccactcctgtggcttctgcaaa
tatgccaaatttgatttcagcatgtatgcccgtgtttgctgcgctgttgatcctatagaa
tcggcagaggatagggtcaagactgtttcactgattcacagctccctagaacgagccgat
agaaattaccgccagctgctgaccaacaagcaaatgctggagcttcttattcaaaaggtg
gccgagcatcgtagcagtgatcgaatggtcgaggacaacatggccagcgtgcacagcact
tctcaagtaaacaagattatacagctgctcgcccagaaatactgtgtggaatcgcgcacc
agtttcgaggagctaagcaagatcgttcagaaggtcaaggcatgtcgaagcgaactagtg
gcctacgatcgtcaacagcaggaccagccgccggttaatcccggctcaacaaccggtgcc
gaaaatcccaccacaaatcgctgctacggctgtgcactggcatctaccgagcagtgtctg
acgcttctgcgagccatggcttacaattacgattgtcgcgtgtgcttgtatagtcaggga
ctcgtcagtgaactggctgagcacaacctgcgacgaggcactcccctaattcaggaggaa
gtgcgcaacctgttggtcgtactgactaaggataatgccgaggcatgcatgcatctgttg
cagttggtgaccacaagggtgaagaatgctctgatgggatcgattcctctgataagttta
gaggcagctgtgcaccaagaaatgacacttttggaggtgctcttgggccaggacgacatc
tgctgggaatacaagctaaaggtcatctttgagctgttcattagcaactgccgtttgcct
cgtggtccggtaacagcagtactacacccctgtctgcgcatcatgcagaatctcatctgc
ccggttctgcccggcagcaagcccaatcagaaggtggccactacagatttgtgtagcatg
aagatgtttgagggcaacacggtggactatagggcctggctgaactcagaccgtaatcat
gaatacgcagcgtggagcaagcggatgccgtcaaacaaccaggctaagctaaagaatgcc
aaggatcagaatgtggcggcatccggcggatcagatgcaccgccgaagagcaggagggag
gtgcgagtcgcattccttagcgaaaagtacggaaaacgctggcgggaacgtgtgctggac
aagcaacgagtgattaaacctcttgtattcaacgccaagtggatacaaccgttgctattt
aatgcaaactccagattcggtcgccagctggcctgctccttgctgagcagcttgagccga
actaacgaacggcggcaacaggctctgaatatgctgacatcgttcttgaaacatgtaggc
gaagcaggggaagccagtgcagagtacttaatgctgtacaagaacatggccacagagcaa
ccctggctgcagtatttggtcctgaaaggagtattaagtcaaatctcacagcttctggct
attgaaatcagcaaggtgcaccgcatggaggagtactcgctttcttcagatttatcctta
ggatatgcactgcgccagtatgtggaattgttgtggctactcctagagtgtccaaatatc
cgcagaacctacaagactcgcatgctaggaccagttctggaaagctatcttgccctaaga
agcttagtcgtgcagcgtacgcgactcattgacgacgcacaggagaagctgttagagatg
ctagaggatatgaccagcggaaccgaggaggagacacgtgcctttatggaaatccttatt
gacaccgtagagaagacccgcatgaatgacattaaaacaccggtgtttgtcttcgagcgc
ttatattccattattcatcccgaggagcatgacgaaagcgagttctatatgacattagag
aaagatccccagcaggaggactttctgcaaggtcgcatgctgggtaatccttacccctcg
agtgaaatgggattgggtccattgatgcgggatgtgaagaataagatttgtacggattgt
gaactaatcgccctgttggaagatgataacggcatggaattgctggtcaacaacaaaata
ataagcttggatctgcccgttaaggatgtttacaagaaagtttggttagctgaaggaggc
gaccgagatgccatgagaattgtatatcgcatgcgcggtctcctgggagacgccacagag
gaatttgtggaaacgctgaacaacaaaagccaggagcaggtggacaccgagcagctgtat
cgcatggccaatgtgctggctgattgcaacggcctacgcgtaatgttggaaagaattggc
agcctgcagcgcatatcgcgcaaccgagaacttatccaggtactgcttaagctattcctt
atttgtgtgaaagtgcgccgttgccaagaggtgctttgccaacccgagatcggagccatc
aacacgctgcttaaggtgctacaaatgtgtctccagtcggagaacgattcgattcaatcg
gcggttaccgagcagttattggagatcatggaaacaatactatcgaaggcggccagcgat
acgttggactcgttcctgcagttctccttgacattcggtggaccggagtatgtaagcgca
ctaatatcgtgcacagactgtcccaatgttagaaacaatccttcggtgctccgccatctt
attcgtgtcctagccgctttggtctatggcaacgaggtgaagatggctctactttgcgag
catttcaaggacactttgaactttaatcgctttgacaacgagcgcacacctgaagaagag
ttcaagctggaactcttctgcgtgctgactaaccaaattgagcacaactgcattggcggc
actctcaaggactacatagtaagtctcggcatcgttgagcgatcgctagcctacatcacc
gagcatgcgccttgtgtcaagcccactctcctgcgaaccgactccgatgagctgaaagaa
ttcatctcgcggccaagcttgaagtatattcttcgtttcctcaccggcctctcaaatcat
catgaggcaactcaggtggctattagcaaggacattatacccattattcatcgcctggaa
caagtatccagcgatgagcatgtgggcagtctggccgagaaccttttggaagctctctcc
accgattcggcgacagcagcgagggtgcagcaagtgcgtgacttcacaagggcagagaag
aagcggctggcaatggccacgcgcgagaaacagttggatgcattgggaatgcgcacgaat
gaaaagggccaggtgacggccaagggctccatcctgcagaagatcgaaaaactgcgcgac
gaaacaggactaacttgctttatttgtcgcgaaggctacgcctgccagccagacaaggtg
cttggtatctacaccttcaccaagcgctgcaatgtcgaggagtttgagctgaagtcgaga
aaaaccattggctataccaccgtcacacacttcaatgtggtccatgtggactgccacaca
tcagccataagattgacacgtggcagggatgaatgggagcgtgctagtttgcaaaatgcc
aacaccagatgtaatggactgctgcccctttggggacccgccgttggagaggcggccttc
tccgcttgcatgacccgccacagcagttatatgcaggagagtacccagcgctgtgacatc
tcctacaccagcagtgtgcatgacttgaagctgctgttggtacgatttgcttgggaacgc
agcttccatgacgatgccggcggaggtggtccgcaatcgaacatgcacttcgtaccctac
ctgctcttctactccgtctatctgttgctttcgtcgcgatcagcggctagagacagcaag
actctgctgacgtatttgcaggcgccgcccagcgagaagtggttggaatgcggatatgag
gtggatggtccgcttttcatggcaaccatttcgctgtcactgcacagccgagagctatgg
aataagcataagctagcacatctgaagaggatgattgcagtggcccagggtcgccacgtc
tcacccgccgtgctgtgcaaagccttgttggctcctgcagaccgccaggtcaaggattac
actgtttacaagcccttccttatgatgtgggcattggtggacttgatctacgacaatctg
ttcaagacggtaagcacgcccaaggaggaggattggccgatttccctgttcgactatctt
cgtaagaacgatgaggctttgctcaagtccacggatagcatcctgcagaccctaacggag
gagttcctgccctgcacttcctttgtcgaattctgtgatgttgcaggtctcctgcatctc
atcgagcacccggacaacttcatcgaagaaatcctcgctgccctgccttcaacatcgagc
tctaattaa

DBGET integrated database retrieval system