KEGG   Drosophila melanogaster (fruit fly): Dmel_CG14512
Entry
Dmel_CG14512      CDS       T00030                                 

Gene name
CG14512
Definition
(RefSeq) uncharacterized protein
  KO
K07432  beta-1,4-N-acetylglucosaminyltransferase [EC:2.4.1.141]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00510  N-Glycan biosynthesis
dme00513  Various types of N-glycan biosynthesis
dme01100  Metabolic pathways
Module
dme_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    Dmel_CG14512 (CG14512)
   00513 Various types of N-glycan biosynthesis
    Dmel_CG14512 (CG14512)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dme01003]
    Dmel_CG14512 (CG14512)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.141  N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase
     Dmel_CG14512 (CG14512)
Glycosyltransferases [BR:dme01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   Dmel_CG14512 (CG14512)
SSDB
Motif
Pfam: Glyco_tran_28_C Ribosomal_L7Ae SpoU_sub_bind
Other DBs
NCBI-GeneID: 43443
NCBI-ProteinID: NP_651673
FlyBase: FBgn0039639
UniProt: Q9VAP1
Position
3R
AA seq 171 aa
MHLNTVYITVGTTKFDALISTASTEPALKALQNRKCTKLVIQHGNSQPLTDDEIQLIRKN
YGIQIEQYNFRPNTEDIKSADLIIGHAGAGTCMDILNNQKPGLIVINDTLMDNHQLELAK
QLAAENYLYYCKVTDVDAQLATLDFEALKPYETKPENLSKFVSAINQLMSH
NT seq 516 nt   +upstreamnt  +downstreamnt
atgcatttgaacactgtttacattaccgttggtaccaccaaattcgatgctctaatatca
actgcatccacggaacccgcactcaaagctctacagaaccggaaatgcaccaaactcgtc
atacagcacggaaattcgcaaccattaacagacgatgaaatacaattgataagaaaaaac
tacggaatccagatagagcagtacaatttccggccaaatacggaggacatcaagtccgca
gacctaattattggacatgcgggagccggaacttgcatggatatactaaataaccagaaa
cctggactcattgtgataaatgacacgctcatggacaatcatcaactggagttggccaag
caactggccgctgaaaactatctgtattactgcaaagttaccgacgtggatgcccagcta
gctactctggactttgaagccttaaagccctatgaaacgaaaccggaaaatcttagcaaa
ttcgtttccgccatcaatcagctgatgtcccattga

DBGET integrated database retrieval system