KEGG   Drosophila melanogaster (fruit fly): Dmel_CG14641
Entry
Dmel_CG14641      CDS       T00030                                 

Gene name
CG14641
Definition
(RefSeq) uncharacterized protein
  KO
K12872  pre-mRNA-splicing factor RBM22/SLT11
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Dmel_CG14641 (CG14641)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dme03041]
    Dmel_CG14641 (CG14641)
Spliceosome [BR:dme03041]
 Complex B
  Other components
   Prp19-related factors
    Dmel_CG14641 (CG14641)
 Complex C
    Dmel_CG14641 (CG14641)
SSDB
Motif
Pfam: RRM_1 zf_CCCH_4 Torus RRM_occluded zf-CCCH zf-CCCH_2 zf-CCCH_4 zf-CCCH_3 FYVE SpdB Nup35_RRM_2 RRM_7 RRM_3
Other DBs
NCBI-GeneID: 40529
NCBI-ProteinID: NP_649440
FlyBase: FBgn0037220
UniProt: Q95RB1
Position
3R
AA seq 418 aa
MSMSKTTNTYNRQNWEDAEFPILCQTCLGDNPYVRMIKERFGKECKICTRPFTIFRWCPG
ARMRFKKTEICQTCARLKNVCQTCLLDLEYGLPIQVRDAALKVADNMPQSDVNKEYYIQN
IDAQLQDGDGTEAAGAVGRSLAANEMLSKLARTAPYYKRNRPHICSFWVKGECKRGEECP
YRHDKPNEPDDPLCEQNIKDRYYGRNDPVAEKIMKRAASLPTLEPPEDRNITTLYVGNLP
EEITEPELRDQFYQFGEIRSIALVPRQQCAFVQYTKRNAAELAAERTFNKLVIQGRKVSI
KWAHSQAKQGTAAKTDRRFDLAGIPPPSAKPNDYFNLRQEQINVMPAGMKLHQLPSNLVP
ASAYQMYGQPTYAAPYGNATSTALSSSGVNLDSISIPPPPGQVPYPSQDASRMGAVKK
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgtctatgtcaaaaacgactaacacctataaccggcagaactgggaagatgctgaattc
ccaattctgtgccaaacttgccttggcgacaatccgtacgtgcggatgattaaagagcgg
ttcggcaaggaatgcaagatatgcacgcgtccattcacaatatttcgatggtgtcctggt
gctcgtatgcgcttcaaaaagacggagatatgtcaaacgtgtgcgcgcctgaagaacgtg
tgtcagacctgcctcttggacctggagtacggactgccgattcaagtacgagatgcggcg
ctcaaagtggctgacaatatgccacaaagcgacgttaacaaggaatactacatccaaaac
atagacgcccagctgcaggacggagatggcacggaggcggcaggagctgtcggtcgatcc
ctcgccgccaacgagatgttgtccaagcttgcgcgcacagcaccctattacaaaagaaat
cggccgcacatctgctccttttgggttaagggcgagtgcaagcgtggagaggagtgccca
taccgccacgacaagcccaacgagccggacgatccgctatgtgagcaaaacatcaaggac
aggtactacggacgcaacgatcctgtggccgagaagatcatgaagcgtgcagcctcgctt
cccacactcgagccgccggaggaccgcaacatcacaactctctatgtggggaaccttcct
gaagaaatcacggaacccgagctgcgagatcagttctaccagttcggcgaaattcgatca
attgcgctggtgccacgccagcagtgcgcttttgtgcaatacaccaaaagaaacgctgcc
gagctggctgctgagcggacctttaataaactggtgatccagggccggaaggtgagcatt
aagtgggctcactctcaggcaaagcagggcaccgctgcaaagacagacagacgcttcgac
ttggccggcattccaccgcctagcgcgaagcccaacgactacttcaatcttcgccaagag
caaatcaatgtcatgcccgccggcatgaagctgcatcagttgccatcaaatctagttccg
gcgtcggcttaccaaatgtatggtcagcctacttatgcagctccctacggaaacgccact
tccacagccctttcttcctcgggtgtcaatttggattccatatcgattcctccgccaccg
ggtcaagtaccgtatccaagtcaggacgccagtcggatgggagctgttaaaaagtag

DBGET integrated database retrieval system