KEGG   Drosophila melanogaster (fruit fly): Dmel_CG14964Help
Entry
Dmel_CG14964      CDS       T00030                                 

Gene name
CG14964
Definition
(RefSeq) uncharacterized protein
  KO
K12567  titin [EC:2.7.11.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG14964 (CG14964)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG14964 (CG14964)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dme04812]
    Dmel_CG14964 (CG14964)
   04147 Exosome [BR:dme04147]
    Dmel_CG14964 (CG14964)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dmel_CG14964 (CG14964)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   Dmel_CG14964 (CG14964)
Membrane trafficking [BR:dme04131]
 Others
  Actin-binding proteins
   Others
    Dmel_CG14964 (CG14964)
Cytoskeleton proteins [BR:dme04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     Dmel_CG14964 (CG14964)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG14964 (CG14964)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 fn3 Ig_2 ig
Motif
Other DBs
NCBI-GeneID: 38384
NCBI-ProteinID: NP_647779
FlyBase: FBgn0035410
UniProt: Q9VZT8
Position
3L
AA seq 1443 aa AA seqDB search
MGNQPGKLHTHPQGGRPKKNVHWKSAERPSPPGRPILTPVALPEQQPDVVNLRWDRPLHD
GGSPITGYTVEHRRMGSPHWVRATPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDAS
ELSDPLTVTLQRNAITVPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWFKDGYEIFS
SRRTKIVNDNEASVLVIHQVALTDEGEIKCTATNRAGHVITKARLMVQAPPKIRLPRTYE
DGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIAPGGRFEVSNTEKNSLLKIDNVLRED
RGEYMVKAWNRLGEDSTSFLVTVTARPNPPGTPKLNMSFGKSATLSWTAPLDDGGCKIGN
YIVEYFRVGWNVWLKAATTRALSTTLHDLIEGSEYKFRVKAENPYGLSEPSGESELLFIP
DPKRGITKPKSATRIAGDEKDKPKTGAGGMQVPPRRKTLSPPRPQADASTGMSPKQSPSA
KRKPKPQLIDNEQLTHEMSYGTSDHALKMDVRKSPSLNSADSANKPTTDSSNPKLNLTLV
TTTLAPLDKSVPSPKAPRTPATSPLKLFNPKPSGAPKDRSPVQPKPQPLPTPPMETPDKA
SPNPKRSLSPPNKRQPPPLRKSPTPPEPIKVTPALLRSAEPVQLGVNQNVRRFSGQTLSP
ARNVPTLALAVASGVSAVIGEKLPTIEISAPPTPQEEEPPVLERSPSPEPAPKSQSNARR
FSRSADKHDDVHTSNEFMLVVFDKNSKVKDKDKQDSFELDLEDAIQPPPISISAPDLAFL
EFTNLHTTFPLRRSVSSTELLYERAMARFYEAVELEQASKSRKTSRDKLVTPVPHQTPAN
LRKRLGSISEAERLSFERRSEMRRQSADVVSISRKWDSRENVNEMGNLTRIHTTGQLPFE
TRKDLRESEAEEEHEEGEEEHLTESTADDSEDMDLDYDEDLDVDYPPQKKLQQQSSNDLG
SDYTESTASSEQDSIEKFKMELLARTRSPSPRDLETYHPRTMGAGTFTPYRAPTPEQAAV
VLNRPVPLPSPDFVPKPILKRSSNEHMEQAVSPLPSSFASEAPTIIVPPTATVANSNPST
LKMDLAKGIKSFFSRDKRSATEKNTEANEEISNPLERTNAAAIAADLEVKRKAKEEEELR
RKEEERLMQEEAHAAVDHYSDLVKEVGSSHKYHTPLYLDRDELKRAAAKAAAETDEEDML
THAEELKKRRATGGSEDLFLAPPVVRERRLSISEREQLVHVRDAASSLAFHRSPEKPESD
QEHESPKSQQDEEPEYPTVLVVPPPKSKNKNESETESVMSEMVEARPDARGRTRLVKVKR
VIRRRVPSSTRSRDASLTRPAIAEVEGSQQTSLVLSAADRDLLQKAATLAILQSEEQAHE
KVRSALSYCTDLVLFLVACYVYLFKDARLVLPILGLIIYRQLGEAVRGYVPGWLRRRFTG
NGS
NT seq 4332 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcagccgggaaagctgcacacgcatccacaaggcggtcgccccaagaagaat
gtccactggaagtccgcagagcgaccttctccgcctggccgacccatcctgacgccagtg
gcactaccggagcagcaaccggacgtggtgaacctgcgctgggatcggccactccacgat
ggaggttcacccatcactggctatacggtagagcacaggcgcatggggtcaccccactgg
gtgagagccacgcccactcccgtggaccgctgcgatgtgtgcatcagtggactggagccg
ggatggcgttaccagtttcgttgctttgctgagaacattgtggggcgatccgatgccagc
gagctatctgatccgctgacggtgacgctgcagcgaaatgccataaccgtgccccggttc
atcgacgaactggtggacacgaatgccgtggaagacgagcgaatcgagttccgcgtccgc
attcttggcgaaccgccgccggagattaactggttcaaggacggctacgagatcttcagc
agtcggcgcacaaagatcgtcaacgacaacgaggccagtgtcctggtgatccaccaagtg
gcgctgaccgacgagggcgagataaaatgcacggccaccaatcgagcgggacatgtgatt
accaaggcaaggttgatggtgcaggctcctcccaagatccgattaccccgcacctacgag
gatggactgattgttgaggcggacgaagtgttgcgccttaaggttggcgtggctggacag
ccaccgcccgctattacgtggcttcatgagggcgaggtcattgctccgggtggacgcttt
gaggtctccaacacggagaagaactccctgcttaagatcgacaatgtgcttcgagaagat
cgcggcgagtatatggtgaaagcttggaatcgattgggtgaggacagtacctcctttttg
gttacagtgacagccaggcccaatccaccgggtactcccaagctgaatatgtcctttggc
aagtccgccactctttcctggacggctccactcgacgacggaggctgtaagattggcaac
tacatagttgaatatttccgagtgggctggaacgtctggctgaaggcggccaccactcgg
gcactgagcaccacacttcacgatctgatagagggttccgagtacaaatttcgtgtaaag
gcagaaaatccatatggcctgagcgaaccgtcgggtgaatcggagctgctcttcatcccg
gatcccaagcggggaatcaccaaaccgaaatcagctacaaggatagccggagatgagaag
gacaagcccaagacaggagctggagggatgcaggtgccaccgcgcaggaagactttatct
cctccacggcctcaagcagatgcctccacgggcatgtcacccaaacagtcgcccagtgcg
aagcggaagccgaagcctcagctcatagacaacgagcaactgacccacgaaatgtcctac
ggaacttcggatcatgctctaaagatggacgtgcgcaagagtccttcgcttaatagcgcc
gattcggctaataaacccacgacagatagttccaatccaaagcttaacctcaccctggtg
accacaacactggcaccgctggacaagtctgtaccatcccccaaggcaccaaggactcca
gctacatctcccttgaaacttttcaatccgaaaccctctggagcccctaaagataggtca
ccagtgcagccaaagccacagccattgcctactccacccatggaaacgccggataaggca
tcacccaacccgaagagaagcttaagtccacccaacaagagacaaccaccgcctcttcgc
aagagtcccacgcctccggaacctataaaggttaccccagctctgttgaggagtgcggag
cccgttcaactgggagtcaaccagaatgtaaggcgattctctggacaaaccctaagcccg
gccagaaatgtgccaactctggcgttggcagtggcttccggtgtgtcagctgtaattggc
gagaagctgcccactatcgaaataagtgctccaccaacgccccaggaggaagagcctcca
gtactggagcgcagtccgtctccagaaccagctccaaagtcccagtccaacgcaaggcgg
ttctccaggtcagccgacaaacacgacgacgtccacacaagcaatgagtttatgctggtc
gttttcgacaagaatagcaaggtcaaggataaggacaaacaagattccttcgagctggac
ctggaggacgccatccagccaccaccaatttcgatttctgcgccggatctggccttccta
gagtttacaaacttgcacaccaccttcccactgcgtcgctctgtcagctccacggaactc
ttgtatgaaagggccatggccaggttctacgaagcagtggaactcgagcaggcttccaag
tcccgcaagacgtcgcgggacaaactggtcactccggttccccaccaaacgcctgctaat
ctccgcaagcgtctgggttccatatcagaggctgaacgcttgtctttcgaaagaagaagc
gagatgcgacgtcaatcggccgatgtggtatccatttcccggaaatgggactccagggag
aacgtcaacgagatgggaaacctgacacgtatccacaccactggacaattgccctttgag
acgcgaaaggatcttcgcgagtcggaagcggaagaggaacatgaagagggagaggaagaa
cacttaactgagagtacggctgatgatagcgaggatatggatctggattacgatgaggat
ttggacgtggattatccgcctcaaaagaaactgcagcagcagtccagcaacgacctcggt
tcggattacacagagagcactgcatcctcggagcaggactccatcgagaagttcaagatg
gaactgctggcccgcacccgatcgcccagtcctcgggatctggagacctatcatccgcgt
accatgggtgctggaacctttacaccatacagggctcccactccagagcaggctgccgtt
gtgctcaaccgaccagtgcctctgccaagtccagactttgtccccaagccgatccttaag
agatcctctaatgagcatatggagcaagctgttagtcccttgccgagtagttttgccagc
gaagcaccgactatcatagtgccgccaactgcaactgtagcaaatagcaatccaagcacc
cttaaaatggacctggctaagggtattaagtcctttttcagccgcgacaagagatccgcc
acggagaagaacacagaggccaacgaagagatatccaatccgttggaaaggaccaatgct
gctgccattgccgcggacttggaagtcaagagaaaagctaaggaggaggaagaactgcgt
cgcaaggaggaggagcgcctcatgcaggaggaggcccatgcagcagtggatcactacagc
gatttggtgaaggaggtgggtagttcccacaaataccatacgcctctatacctggaccgg
gatgaactgaagcgagcggctgctaaggcagcagcggaaactgacgaggaggacatgctc
acccatgcggaggaactgaagaagagacgtgccaccggtggcagcgaagacctgtttctg
gctcctccagtggtcagggagagacggctctccatctcggagcgggagcaacttgtccac
gtccgggatgcagccagcagtctggcattccaccgatcgcccgaaaagccagaatctgac
caggagcacgagtcaccgaaatcgcaacaggatgaggaaccagagtaccccactgttctg
gtggtgccgccacccaaatcaaagaacaagaacgaatctgagactgagagcgtcatgagc
gagatggtggaggctcgtccggatgccaggggccggactcgcttggtgaaggtgaagagg
gtgatcaggcgaagggtgccttcgagcactcgatcacgagacgcctcactcaccagacct
gcgattgcggaagtagagggcagtcagcaaacatccttggtcctctccgccgccgacagg
gacttgctgcagaaggcagccactctggccatcctccagtcggaggagcaggcgcacgag
aaggttcgctcggctctcagctactgcacagatctggtcctcttcctggtcgcctgctat
gtgtacttgttcaaggacgcacgcttggtcctgcccattctgggccttatcatctacagg
cagctgggcgaggcagtgcggggttatgtgcccggctggctgcgccgcaggttcaccggg
aatggtagctag

DBGET integrated database retrieval system