KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15269
Entry
Dmel_CG15269      CDS       T00030                                 

Gene name
CG15269
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-met zf-C2H2_6 Zn-ribbon_8 zf-LYAR zf-Di19 zf-C2H2_9
Other DBs
NCBI-GeneID: 34887
NCBI-ProteinID: NP_609739
FlyBase: FBgn0028878
UniProt: Q7KT79
Position
2L
AA seq 587 aa
MLQRSYDLSPSPARTSPTNGVQNLGAGAQLPPAQVTDFSISKILGKERKSAQDTSTNILD
LSKSSSNSIRSPQALGGLAIPSTPYASGAYSMLPPDLVAMANATKFYAQFFPHLLPAYAA
AAAAAGLSTPPTSPYQTHQHQQHLPNQQKRFFAPYVINGSVPPPPPLQQQQQPLIRTKST
ACTRPDCPECLDYYQRLQTGGYKQTAPLISPAASSVSSSTGSIRPVRDLIMSATGGAAST
NISLTTVTNLSLNSVQATAVGMMPKMTGGLITTAVGSNSGAIGGIGGYNATSAEEISYKC
RICEKVFGCSETLQAHEKTHKSPRYECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPEC
GKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRF
SRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKH
HLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRTHAKKCQYRPLDGLTVTSSALPVPGKQ
QTGPPPTLAMAMAQTFQMPPPPGVLTPGSGPSQPPSQQTLLSNLRTF
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgctgcagcgcagttacgacctttcgccctcgccggcgcgtacttcacccaccaatgga
gtccagaacttgggagctggggcacagttgccaccggctcaagtcactgactttagcatc
agtaagattctgggcaaggagcgtaaatccgctcaggatacgagcacgaatatcctggat
ctatccaagagcagtagcaacagtattaggagcccacaggctcttggagggctggcaata
ccatcaactccttatgcctccggtgcctactccatgttgccgccagatttggtggccatg
gccaatgccaccaagttctatgcccaattcttcccgcacttactgcccgcctatgcggct
gctgcagcggctgccggcttgagtactcctcctacgtcgccctatcaaacacatcagcat
cagcagcatttgccaaatcagcagaaacgcttctttgctccctatgtgatcaatggatcg
gttcccccaccaccaccactgcagcagcaacagcaacctctcatacgcaccaaaagcacc
gcatgcactcgtccggattgcccggagtgcctggattattaccaaagattgcagactggt
ggctataagcagaccgcacctctcatctcacccgccgcctcctcggtgagcagttccacc
ggatcaatacgtcctgtgagggatctgattatgagtgccactggaggagccgccagcact
aacatctcactgaccaccgtgaccaatctgagtctgaactcggtccaggcaacggccgtc
ggaatgatgcccaagatgaccggtggactgatcaccacagccgtcggcagcaacagtgga
gcaatcggtggtatcggtggatacaatgccacatccgccgaggagatcagctacaagtgc
cggatttgcgagaaggtattcggatgctctgaaactctgcaggctcatgaaaagacgcac
aaatcgccgcgttacgagtgtgcggattgtggaaagggtttctcccagctgcgaaattac
aaatatcacctgtccgttcaccgaggaaccaaggagtttgccgccgagtgtcccgaatgt
ggcaagacattcaacgataagggatatttgagcagtcacctaaagattcaccggaaccgg
aaggagtacgagtgtccttactgtcccaaatcgttcaatcagcgtgtggccttcaatatg
catgtccggattcataccggcgtgaaaccccacaaatgcaacgagtgcggaaagagattt
tcgcgtaaaatgctgctcaaacagcacatgaggacgcacagtggtgagaaaccgtatcag
tgctccgtgtgcggcaagtcctttgccgatcgcagcaacatgaccctgcaccatcgcctc
cactcgggaatcaagcccttcagctgccccctgtgccccaaagccttcaccaaaaagcat
cacctaaagacgcatctgaattaccatacaggctgcaagccgtatgtctgcccacatccc
aactgcaatcaggcattcacccagtcgagcaatatgcgaacccacgctaagaagtgtcag
taccgtccgttggatggactcacggtcacatcatccgcacttccagtaccgggaaaacaa
caaacaggtccaccgcccactttggccatggccatggctcaaacatttcaaatgccgcca
cctcctggagttctaacacctggatctggtccatcccaaccgccgagtcagcaaaccctt
ctcagcaatctcaggacattctaa

DBGET integrated database retrieval system