KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15274
Entry
Dmel_CG15274      CDS       T00030                                 

Gene name
GABA-B-R1
Definition
(RefSeq) metabotropic GABA-B receptor subtype 1, isoform C
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dmel_CG15274 (GABA-B-R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dme04030]
    Dmel_CG15274 (GABA-B-R1)
G protein-coupled receptors [BR:dme04030]
 Metabotropic glutamate receptor family
  GABA
   Dmel_CG15274 (GABA-B-R1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 Peripla_BP_6 PhoLip_ATPase_C Tetraspanin Wtap DUF6377 CNP1
Other DBs
NCBI-GeneID: 34878
NCBI-ProteinID: NP_001246033
FlyBase: FBgn0260446
UniProt: Q9V3Q9
Structure
PDB: 
5X9X 5GWM

Position
2L
AA seq 841 aa
MTSDGAVTFWIFLLCLIASPHLQGGVAGRPDELHIGGIFPIAGKGGWQGGQACMPAARLA
LDDVNKQPNLLPGFKLILHSNDSECEPGLGASVMYNLLYNKPQKLMLLAGCSTVCTTVAE
AAKMWNLIVLCYGASSPALSDRKRFPTLFRTHPSATVHNPTRIKLMKKFGWSRVAILQQA
EEVFISTVEDLENRCMEAGVEIVTRQSFLSDPTDAVRNLRRQDARIIVGLFYVVAARRVL
CEMYKQQLYGRAHVWFFIGWYEDNWYEVNLKAEGITCTVEQMRIAAEGHLTTEALMWNQN
NQTTISGMTAEEFRHRLNQALIEEGYDINHDRYPEGYQEAPLAYDAVWSVALAFNKTMER
LTTGKKSLRDFTYTDKEIADEIYAAMNSTQFLGVSGVVAFSSQGDRIALTQIEQMIDGKY
EKLGYYDTQLDNLSWLNTEQWIGGKVPQDRTIVTHVLRTVSLPLFVCMCTISSCGIFVAF
ALIIFNIWNKHRRVIQSSHPVCNTIMLFGVIICLISVILLGIDGRFVSPEEYPKICQARA
WLLSTGFTLAYGAMFSKVWRVHRFTTKAKTDPKKKVEPWKLYTMVSGLLSIDLVILLSWQ
IFDPLQRYLETFPLEDPVSTTDDIKIRPELEHCESQRNSMWLGLVYGFKGLILVFGLFLA
YETRSIKVKQINDSRYVGMSIYNVVVLCLITAPVGMVIASQQDASFAFVALAVIFCCFLS
MLLIFVPKVIEVIRHPKDKAESKYNPDSAISKEDEERYQKLVTENEELQRLITQKEEKIR
VLRQRLVERGDAKGTELNGATGVASAAVATTSQPASLINSSAHATPAATLAITQDTHEHR
T
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgacaagtgatggtgctgttacgttttggatatttttgctttgtttaatcgcctcgccg
cacctgcaagggggcgtggccgggaggcccgatgaactgcacatcggcggcatctttccg
atagccggcaaaggaggatggcagggcggccaggcgtgtatgcctgccgcaagactggcg
ttggatgatgtcaacaagcagccaaatctgctgccgggcttcaagctcatcctgcacagc
aacgacagtgagtgtgagcccggtttgggcgccagcgtgatgtacaatctgctctataat
aaaccgcaaaagctgatgctgttggcaggatgcagcacggtctgcaccactgtagccgag
gctgccaaaatgtggaatctaattgtgctctgctacggggcctcgagtccggctctttcg
gatcgcaaacgattccccactctattccgcacccatccatcggccacggtgcacaatcca
acgcgcatcaagctgatgaagaaattcggctggtcccgggtggccattctgcagcaggcg
gaggaggtctttatatcgaccgtagaggatctcgagaatcgatgcatggaggctggcgtt
gaaatcgtaactagacaatcatttctatccgatccaacagacgccgtgcgcaatttgcga
cgccaggatgcacgcatcattgtgggactcttctatgtggtggccgccaggagggtgctc
tgcgaaatgtacaaacagcagctatatggccgagctcatgtgtggttctttattggctgg
tacgaggacaactggtacgaggtgaatctgaaagcagagggcatcacctgcactgttgaa
cagatgcgaatagctgccgaaggacatctgacaacggaagcgctcatgtggaatcagaac
aatcagacaactatatccggaatgactgcagaggaatttcgacatcgactgaatcaggcg
ctaatcgaggagggttacgacattaaccacgatcgctatccggagggatatcaggaggcg
ccactcgcctacgatgcagtgtggagtgtggctttggctttcaacaagaccatggaacga
ttgacaaccgggaagaaatctctgagggattttacctatacggacaaggagattgccgat
gaaatctacgctgccatgaactccacacaatttctgggtgtatcgggtgtggtggcattc
agttctcagggcgatcgtattgctcttacacagatcgaacagatgatagacggcaagtac
gagaagttgggttactacgatactcagttggataacctatcctggttgaatactgaacag
tggattggtggcaaggttcctcaagatcgcacaattgtcacccatgttctacgcaccgtg
tccttgccattatttgtgtgcatgtgcacaatatccagttgtggcatattcgttgccttc
gccttgatcatctttaatatatggaataagcatagaagagtaatacaatcctcgcatccc
gtttgcaatacgatcatgttatttggtgtcatcatctgtctaatatctgtcatcttactg
ggcatcgacggacgctttgtcagccccgaggaatatccaaagatatgtcaagcgcgggct
tggttactatccaccggttttacactagcatacggtgctatgttcagcaaggtctggcgt
gtgcatcgttttacaacaaaagcaaaaactgacccaaagaaaaaagtggaaccttggaag
ctatacaccatggtttcggggctattatcaatagatttagtgatattactctcatggcag
atctttgatccgctgcagcgttatctcgaaacattcccactcgaagatccagtatctact
actgatgatattaaaatacgtccagagcttgagcattgtgaaagtcaacgcaactccatg
tggttgggtcttgtatacggcttcaaggggctaatcctggtgtttggcctctttttggcg
tacgagacgcgctccattaaagtgaaacagatcaacgattcgcgttatgtgggcatgagc
atctataacgtggtcgtcctttgcctgataacagctccggtgggcatggtcattgcatcg
caacaggacgcgtcctttgccttcgttgctctagctgtgatattctgttgtttcctaagc
atgctgctgatatttgtgccaaaggtcattgaggttatacgtcatcccaaggataaggcc
gaatcgaaatacaatcccgattcagccatatcgaaagaggacgaagaacgctatcagaaa
cttgttaccgaaaacgaggaattgcaacgattaataacacagaaggaggaaaagattcga
gtcctgcgacagcgtctggtggagcggggcgacgccaagggcacagaactgaatggtgca
acaggtgtcgcctccgccgccgttgcaacaacttcgcagcccgcttccctcatcaactca
tcagcacatgccacgcccgcagccacactcgcaatcacacaagatactcatgagcatcgt
acatga

DBGET integrated database retrieval system