KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1528
Entry
Dmel_CG1528       CDS       T00030                                 

Gene name
gammaCOP
Definition
(RefSeq) coat protein (coatomer) gamma, isoform B
  KO
K17267  coatomer subunit gamma
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG1528 (gammaCOP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG1528 (gammaCOP)
Membrane trafficking [BR:dme04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    Dmel_CG1528 (gammaCOP)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG1528 (gammaCOP)
SSDB
Motif
Pfam: Adaptin_N COP-gamma_platf Coatomer_g_Cpla HEAT_2 Cnd1 HEAT_EZ NPCBM_assoc
Other DBs
NCBI-GeneID: 43717
NCBI-ProteinID: NP_733432
FlyBase: FBgn0028968
UniProt: Q8I0G5
Position
3R
AA seq 883 aa
MNYFSLTSHKKHRGHPSAGPSNAYQNLEKTSVLQETRTFNETPVNPRKCIHILTKILYLI
NQGEQLVAREATDCFFAMTKLFQSKDVVLRRMVYLGIKELSSIAEDVIIVTSSLTKDMTG
KEDLYRAAAIRALCSITDNTMLQAVERYMKQCIVDKNAAVSCAALVSSLRLANTAGDVVK
RWANEAQEALNSDNIMVQYHALGLLYHIRKSDRLAVSKLVNKLTRGSLKSPYAVCMLIRI
ACKLIEEEDIPSEELSDSPLFTFIESCLRHKSEMVIYEAAHAIVNLKNTNPRMLSPAFSI
LQLFCSSPKATLRFAAVRTLNKVAMTHPAAVTTCNLDLEGLITDSNRSVATLAITTLLKT
GAESSVERLMKQISTFVAEISDEFKVVVVQAICALCTKYPRKHTVLMNFLSGMLREEGGL
EYKTSIVDTIITIIEENADAKESGLSHLCEFIEDCEHVSLAVRILHLLGKEGPFAATPSK
YIRFIYNRVILESPIVRAAAVTAMAQFGASCPALLSNILVLLGRCQMDPDDEVRDRATYY
LSILNSERPELYKNYIIERENCSLALLEKSLVEHLNGDVDTRFDISIVPKAAIVKPVIAN
DVMLVTSSAPRPPKITREEESAARLAQLPGIQVLGPIHRSTAPIQLTESETEYTVQCIKH
IFGQHVVFQFDCLNTLSDQILENVRVELTLPEGFTTRAVIPCPKLPYNDLQTTFVIVEFP
PDAANSIATFGATLRFVVKDCDPNTGEPESEEGYDDEYMLEDLELTVADQIQKTRKNNFQ
VSWDAADSEEWLQAEDTFVLSAVTTLQDAVNTIVKILGLGAANLSENVPEGTHLHTLLCS
GTFRGGAEILVRAKLALSEGVTLNLTVRSTDQDVAELITAAIG
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgaactatttttcccttacctcgcacaaaaaacatcgcggccatccgtcagcaggaccg
agcaatgcgtaccagaacctggaaaaaacctcggtgcttcaggagacgcgcaccttcaat
gagacgccggtgaacccaaggaagtgcatccacatcctgaccaaaatcctgtacctgatt
aatcagggtgagcagcttgtggcccgcgaggccaccgactgcttttttgcgatgacgaag
ctcttccaatctaaggacgtggtgctgcgtcgtatggtatacctgggcatcaaggagctg
agctccattgccgaggacgtcatcatcgtgactagctcgctaacgaaggatatgaccggc
aaggaagacctgtacagggccgccgcaatccgggccttgtgcagcatcacggataacacc
atgttgcaggccgtggagcgctacatgaagcagtgcattgttgacaaaaacgcggcagtt
tcttgtgctgcattggtcagttctttgagattggccaacactgccggcgacgtggtcaag
aggtgggcaaacgaggcccaggaggctttgaacagcgacaacattatggtacagtaccac
gcgttgggtctgctctaccatatccgcaagtcggatcggctggctgtctccaagttggtc
aacaagctgaccagaggatctctaaagagtccctatgccgtttgcatgctgatacgcatt
gcctgtaagctgatcgaggaggaggacattccctctgaggagctttccgattcacccttg
tttacgttcatcgagtcctgtctgcgccacaagagcgagatggtcatctacgaggcggcc
cacgccattgtcaacctcaagaacaccaatccgcgaatgctatcgccggcgttctccatc
ctccagcttttctgcagctcgccgaaggcaacgttgcgctttgcggctgtgcgcacgctt
aacaaggtggcgatgacgcacccggctgcggtgaccacctgtaacttggacctggaaggt
ctcatcacggactccaatcgatcggtggccactctggccatcactacgctgctaaagacc
ggcgctgaatcctcggtagagcgtctgatgaagcagatctccacgtttgtggcggagatt
tccgatgaattcaaggtggtggtcgtgcaggccatttgcgctctgtgcaccaaatatccg
cgcaagcacacagtgctgatgaacttcctcagcggtatgctgcgcgaggagggtggcctt
gaatacaagacctccatagttgacaccatcatcacgatcatcgaggagaatgcggacgcc
aaggagtccggtttgtcgcatctgtgcgagttcatcgaggattgtgaacacgtttcactg
gcggtgaggattcttcacctgctgggcaaggagggaccctttgcggccacaccctccaag
tatatacgctttatctacaaccgcgtcatcttggagagccctattgtgcgagcagccgcg
gtcacggccatggcccagtttggagcatcttgcccagccttgttaagcaatatcctcgtt
ctgctgggtcgttgccagatggacccggacgacgaggtgcgtgaccgtgccacctactac
cttagcattcttaactcggaaaggccagagctgtacaagaactacatcatcgaaagggag
aactgttctctggctctgctggagaagtcgctggtcgaacatctgaatggtgacgtggac
acacgcttcgatatttccattgtgcccaaggcggccatagttaagccagttattgccaac
gacgtaatgctagttaccagcagtgctccacggccgccgaagatcacgcgcgaggaggag
agtgctgcacgtctggcacagctgccgggcatccaggtgctgggccccatccatcgcagc
acagctcccatccagcttactgaaagtgaaacggagtacacggtgcagtgcatcaaacac
atattcggccagcacgtggtcttccagttcgattgcttgaatacgctgtccgaccaaatc
cttgaaaatgtgcgggtggaactcacgctgccggaaggattcacaaccagggcggtcatt
ccatgtcccaagctaccctacaacgatctgcaaaccacttttgtcatcgtagaattcccg
cccgacgccgccaattccatagccacctttggtgccactttacgatttgtggtcaaggac
tgcgaccccaacaccggcgagccggagtcagaggagggctatgacgacgagtacatgcta
gaggatttggagctgacggttgccgatcagatacagaaaaccagaaagaacaatttccaa
gtgtcctgggatgcggctgacagcgaagaatggctacaagccgaggatacctttgtgctg
tcggcagtgaccaccttgcaggatgccgtcaacactatagtcaagatcctgggcttgggc
gctgcaaacctctctgagaatgtgcccgagggtacgcacctgcatacgttgctctgttca
ggaaccttcagaggcggcgccgagattcttgtgcgggccaagctggcgctttcagaaggc
gtcacgctcaatctgacggtgcgcagcacggaccaggacgtggcggagctgataacggcg
gccattggataa

DBGET integrated database retrieval system