KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1554
Entry
Dmel_CG1554       CDS       T00030                                 

Gene name
RpII215
Definition
(RefSeq) RNA polymerase II 215kD subunit
  KO
K03006  DNA-directed RNA polymerase II subunit RPB1 [EC:2.7.7.6]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    Dmel_CG1554 (RpII215)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dme03021]
    Dmel_CG1554 (RpII215)
   03400 DNA repair and recombination proteins [BR:dme03400]
    Dmel_CG1554 (RpII215)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     Dmel_CG1554 (RpII215)
Transcription machinery [BR:dme03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     Dmel_CG1554 (RpII215)
DNA repair and recombination proteins [BR:dme03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      Dmel_CG1554 (RpII215)
SSDB
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_6 RNA_pol_Rpb1_7 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4
Other DBs
NCBI-GeneID: 32100
NCBI-ProteinID: NP_511124
FlyBase: FBgn0003277
UniProt: P04052 D0Z769
Position
X
AA seq 1887 aa
MSTPTDSKAPLRQVKRVQFGILSPDEIRRMSVTEGGVQFAETMEGGRPKLGGLMDPRQGV
IDRTSRCQTCAGNMTECPGHFGHIDLAKPVFHIGFITKTIKILRCVCFYCSKMLVSPHNP
KIKEIVMKSRGQPRKRLAYVYDLCKGKTICEGGEDMDLTKENQQPDPNKKPGHGGCGHYQ
PSIRRTGLDLTAEWKHQNEDSQEKKIVVSAERVWEILKHITDEECFILGMDPKYARPDWM
IVTVLPVPPLAVRPAVVMFGAAKNQDDLTHKLSDIIKANNELRKNEASGAAAHVIQENIK
MLQFHVATLVDNDMPGMPRAMQKSGKPLKAIKARLKGKEGRIRGNLMGKRVDFSARTVIT
PDPNLRIDQVGVPRSIAQNLTFPELVTPFNIDRMQELVRRGNSQYPGAKYIVRDNGERID
LRFHPKSSDLHLQCGYKVERHLRDDDLVIFNRQPTLHKMSMMGHRVKVLPWSTFRMNLSC
TSPYNADFDGDEMNLHVPQSMETRAEVENIHITPRQIITPQANKPVMGIVQDTLTAVRKM
TKRDVFITREQVMNLLMFLPTWDAKMPQPCILKPRPLWTGKQIFSLIIPGNVNMIRTHST
HPDEEDEGPYKWISPGDTKVMVEHGELIMGILCKKSLGTSAGSLLHICFLELGHDIAGRF
YGNIQTVINNWLLFEGHSIGIGDTIADPQTYNEIQQAIKKAKDDVINVIQKAHNMELEPT
PGNTLRQTFENKVNRILNDARDKTGGSAKKSLTEYNNLKAMVVSGSKGSNINISQVIACV
GQQNVEGKRIPYGFRKRTLPHFIKDDYGPESRGFVENSYLAGLTPSEFYFHAMGGREGLI
DTAVKTAETGYIQRRLIKAMESVMVNYDGTVRNSVGQLIQLRYGEDGLCGELVEFQNMPT
VKLSNKSFEKRFKFDWSNERLMKKVFTDDVIKEMTDSSEAIQELEAEWDRLVSDRDSLRQ
IFPNGESKVVLPCNLQRMIWNVQKIFHINKRLPTDLSPIRVIKGVKTLLERCVIVTGNDR
ISKQANENATLLFQCLIRSTLCTKYVSEEFRLSTEAFEWLVGEIETRFQQAQANPGEMVG
ALAAQSLGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEIINISKKPKAPSLTVFLTGGAA
RDAEKAKNVLCRLEHTTLRKVTANTAIYYDPDPQRTVISEDQEFVNVYYEMPDFDPTRIS
PWLLRIELDRKRMTDKKLTMEQIAEKINVGFGEDLNCIFNDDNADKLVLRIRIMNNEENK
FQDEDEAVDKMEDDMFLRCIEANMLSDMTLQGIEAIGKVYMHLPQTDSKKRIVITETGEF
KAIGEWLLETDGTSMMKVLSERDVDPIRTSSNDICEIFQVLGIEAVRKSVEKEMNAVLQF
YGLYVNYRHLALLCDVMTAKGHLMAITRHGINRQDTGALMRCSFEETVDVLMDAAAHAET
DPMRGVSENIIMGQLPKMGTGCFDLLLDAEKCRFGIEIPNTLGNSMLGGAAMFIGGGSTP
SMTPPMTPWANCNTPRYFSPPGHVSAMTPGGPSFSPSAASDASGMSPSWSPAHPGSSPSS
PGPSMSPYFPASPSVSPSYSPTSPNYTASSPGGASPNYSPSSPNYSPTSPLYASPRYAST
TPNFNPQSTGYSPSSSGYSPTSPVYSPTVQFQSSPSFAGSGSNIYSPGNAYSPSSSNYSP
NSPSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSPNYSASPQY
SPASPAYSQTGVKYSPTSPTYSPPSPSYDGSPGSPQYTPGSPQYSPASPKYSPTSPLYSP
SSPQHSPSNQYSPTGSTYSATSPRYSPNMSIYSPSSTKYSPTSPTYTPTARNYSPTSPMY
SPTAPSHYSPTSPAYSPSSPTFEESED
NT seq 5664 nt   +upstreamnt  +downstreamnt
atgagcacccccacggactcgaaggcgccgttgcgccaggtgaagcgcgtacagttcggc
attttgtcccctgatgaaattcgtcgcatgtccgtcaccgagggtggcgtccagtttgcg
gagacaatggagggcggacgaccaaagctgggcggattgatggatccgcgccagggtgtc
atagacaggacgtcgcgctgtcagacgtgcgccggcaatatgaccgagtgccccggtcac
tttggacacatcgacctggccaaaccagtgttccacatcggcttcatcaccaagacaatt
aagattttgcgatgtgtgtgcttctactgctccaaaatgttggtctcgccacacaatcca
aagatcaaggagatcgttatgaagtctaggggacagccgcgtaagcgcctggcctacgtc
tatgatctgtgcaagggcaagacgatttgcgagggcggcgaggacatggatctcaccaag
gagaaccagcagccggatccaaacaaaaagcccggccacggcggttgcggtcactaccag
ccgtcgatccggagaacaggactggatctcaccgccgagtggaagcatcagaacgaggat
tcgcaggagaagaagatcgtggtctcggcagagcgggtttgggaaatccttaagcatatc
accgatgaggagtgctttattctgggcatggatcccaagtatgcgcgtcccgattggatg
atcgtgaccgtcctgcctgttccaccgttggccgtacggccagcggtcgtgatgtttggt
gctgccaagaatcaggatgatttgacgcacaagctgtccgatatcatcaaggcaaacaat
gagcttcgcaagaacgaggccagtggtgccgcagcgcatgtgatccaggagaacatcaag
atgctgcaattccacgtcgccacactagtggacaacgatatgcccggcatgcccagggct
atgcaaaagtcgggaaaaccccttaaagccatcaaggcgcgactcaagggtaaggagggt
aggattcgtggcaacttgatgggcaaacgtgtcgacttctccgcccgtactgtcatcaca
cccgatccaaatctgcgtatcgatcaggtcggtgtgccgcgttccattgcccagaatcta
accttccccgagctggtcactcccttcaacatcgatcgcatgcaggagctggtgcgcagg
ggtaattcgcagtatccgggtgccaagtacattgtgcgcgacaatggcgagcgtattgat
cttcgctttcatcctaaatcctctgatttacatctgcagtgcggctacaaggtagagcgg
catttgcgcgacgacgatctggtgatcttcaaccgacagcccacgctgcacaagatgagt
atgatgggtcacagggtgaaagtgttgccctggtcgactttccgcatgaacctgtcgtgt
acatcgccctacaatgctgatttcgacggcgatgaaatgaatttgcacgttccgcagtcc
atggagacgcgcgccgaggtggagaacatccacatcacacccagacagatcatcacgccg
caggcgaacaaacctgtcatgggtatcgtgcaggacactctgactgcggtgcgaaagatg
accaagcgcgacgtattcatcacgcgcgagcaggtgatgaatctgctcatgttcctgccc
acgtgggacgctaaaatgccgcaaccctgcatcctgaaaccgcgtcccctgtggacgggc
aaacagatcttctccctgatcatccccggcaacgtgaacatgatacgcacacattccacg
catccggacgaggaggatgaaggaccatacaagtggatctcgcccggtgacaccaaggta
atggtggagcacggtgaacttatcatggggatcctctgcaagaagtcactgggtacatca
gccggatcactgctgcatatttgtttcctggaacttggtcacgatatcgctggtcggttc
tatggcaacattcagaccgtgatcaacaattggttgcttttcgagggccatagtatcggt
attggtgacactattgccgatccccagacctacaacgagatccagcaggccatcaagaag
gcaaaggacgacgtgataaacgttatccaaaaggcccacaacatggagctggagcccacg
ccgggtaatactctgcgtcagacgttcgagaacaaggtgaaccgtatcctaaacgatgct
cgtgacaagactggtggttcggccaagaaatctctcactgagtacaacaatctaaaggct
atggtggtgtctggttccaagggttccaacattaatatatcccaggttattgcttgtgtg
ggtcaacagaacgtggagggtaagcgaatcccctacggtttccgcaaacgcactcttccc
cactttattaaggacgattatggtcctgagtcgcgcggtttcgtggagaattcgtatctt
gccggcctgacaccctctgagttctatttccacgctatgggtggtcgtgaaggtcttatc
gatactgctgtaaagacagctgaaaccggttacatccagcgtcgtcttataaaggctatg
gagtcggtgatggttaactacgacggaacagtgcgtaactcggtgggccagcttattcag
ctgcgttacggcgaggacggtctttgcggcgagctggttgagttccagaacatgccaacg
gtgaaactgtcgaacaagtcgtttgaaaagcgcttcaaatttgactggagcaacgagcga
ttaatgaaaaaggtatttacggatgatgtgatcaaggagatgaccgacagcagcgaagcc
atccaggaactggaggcagagtgggatcgtttggtttccgatcgcgacagtttgagacaa
atcttccctaacggcgaatccaaggtggtactgccgtgcaacctgcagcgtatgatctgg
aatgtgcagaagatctttcacatcaacaagcgcctgcccacggatctctcgcccattcgg
gtgatcaagggcgttaagacattgctcgaacgctgtgttattgtcacgggaaatgatcga
atttcaaagcaggccaacgagaacgccacgttgctattccagtgcctaatccgttcgaca
ctatgtacgaaatacgtgtcggaggagttccgcctgtccacagaggcgtttgagtggttg
gtcggagaaatcgagacgcgtttccaacaggcccaggccaatcccggcgagatggtgggt
gccctggctgcccagagtttgggtgagcccgctactcagatgacactgaacaccttccat
tttgctggtgtgtcttcaaagaacgtaacattgggtgtgccgcgtctcaaggagattatc
aacatatccaaaaagcccaaagcgccgtcgctaaccgttttccttactggcggcgctgct
cgcgatgcggagaaggccaagaacgtactgtgccgcctggagcataccacgctgcgcaag
gttacggccaatacggctatttactacgacccggatccgcagagaacggtgatatccgag
gatcaagaatttgtgaatgtctactacgaaatgcccgactttgatcccacacgcatttcg
ccctggttgctacgtattgaattggaccgcaagcggatgacggacaagaagctgacaatg
gaacagatcgccgagaagattaacgtgggcttcggggaggatctcaattgtattttcaat
gacgacaatgccgataagctggtgctgcgcattaggatcatgaacaacgaagagaacaag
ttccaggacgaagacgaggccgtcgacaagatggaggacgacatgttcttgcgctgcatt
gaggccaacatgctgtcggacatgacactgcagggtatcgaagccatcggcaaggtgtac
atgcatctgccacagaccgacagcaagaagcgtatcgtgatcactgagaccggagagttt
aaggccatcggcgagtggctgctcgagacggacggcacatcgatgatgaaagtgctgtct
gagcgtgacgtggacccaatccgaacatcctccaacgatatttgcgagatattccaggtg
ctgggcatcgaggcggtgcgaaagtctgtcgaaaaggagatgaacgccgtgttgcagttc
tacggcctgtacgtgaactatcgtcacttggccctgttgtgcgatgtgatgacggccaag
ggccatctgatggccatcacccgtcacggcattaacaggcaagacactggtgcccttatg
cgttgctcctttgaggagacagtggatgtgctaatggatgccgccgctcacgccgaaacg
gatcccatgaggggcgtctctgagaacattatcatgggacagctgcccaaaatgggtacc
ggctgctttgaccttctgctcgatgcagagaagtgtcgtttcggcatcgagattcccaat
acgttgggcaacagtatgctaggtggcgccgctatgttcattggcggtggatcgacaccg
agcatgacgccaccgatgacgccgtgggctaactgcaacacgccgcgatacttctctcca
cccggccacgtaagtgccatgactcctggcggtcccagtttctcgccttcggctgcatcg
gatgcgtccggaatgtcgcctagctggtcgccggctcatccgggctcatcgcccagttca
ccaggaccttcgatgtcgccgtatttcccagcctcgccgagtgtttctccctcttattcg
ccaacgagtccgaactacacggcatcttctcccggtggagcctcgccgaattactcgccc
tcgagtccgaactattcgccgacgtcgccgctttatgcaagtccacgttacgcatcgaca
acgccaaatttcaatccacagtcgacgggttactcgccatcttcatcgggatactcgcca
acatccccggtctactcgcccacggtgcaattccagtcgagtccgtcgtttgcgggcagc
ggtagcaacatttactcgccgggcaatgcgtactcgcccagctcgtccaactactccccc
aattcaccatcctactcgccgacatcaccatcgtactcgccgtcaagtccttcgtactcg
ccaacgtcgccttgctattcgcccacatcgccttcgtactcgccaacgagtccgaactac
acacccgtaacaccctcatactcgccgacaagtccgaactattcagcgtcgccgcaatat
tctccagcctcgccagcttactcgcaaacgggggtgaagtactcaccgacatcgccgacg
tactcgccgccgtcaccatcgtacgatgggtctcccggatcaccacaatatacgccagga
tctccgcagtactcgccggcctcgcctaagtactcgccgacctcaccgctgtactcgccc
agctcgccgcagcactcgccctcaaaccagtacagcccaacaggatcgacctattcggcg
acgagtccgcggtactcgccgaacatgtccatctactcgccgagcagcaccaagtactcg
cccacctcgccaacgtacacaccgacggcccgcaactactcgcccacgtcaccgatgtac
tcgccaacggctccatcgcactacagtcccacgagtccggcctactcgcccagcagtccc
acgttcgaggagagcgaagactga

DBGET integrated database retrieval system