KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15793Help
Entry
Dmel_CG15793      CDS       T00030                                 

Gene name
Dsor1
Definition
(RefSeq) downstream of raf1, isoform A
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04068  FoxO signaling pathway
dme04140  Autophagy - animal
dme04150  mTOR signaling pathway
dme04320  Dorso-ventral axis formation
Module
dme_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG15793 (Dsor1)
   04068 FoxO signaling pathway
    Dmel_CG15793 (Dsor1)
   04150 mTOR signaling pathway
    Dmel_CG15793 (Dsor1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG15793 (Dsor1)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG15793 (Dsor1)
 Human Diseases
  Infectious diseases
   05163 Human cytomegalovirus infection
    Dmel_CG15793 (Dsor1)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dmel_CG15793 (Dsor1)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: STE group
  STE7 family
   Dmel_CG15793 (Dsor1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Seadorna_VP7 Haspin_kinase APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 31872
NCBI-ProteinID: NP_511098
FlyBase: FBgn0010269
UniProt: Q24324
Position
X
AA seq 396 aa AA seqDB search
MSKNKLNLVLPPVNTEATVAAATVAPTPPFKTPSGTDTHSLLGKPKTSIDALTETLEGLD
MGDTERKRIKMFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHL
EVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRI
PESILGRITLAVLKGLSYLRDNHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEE
SGQPTDEPRAMAIFELLDYIVNEPPPKLEHKIFSTEFKDFVDICLKKQPDERADLKTLLS
HPWIRKAELEEVDISGWVCKTMDLPPSTPKRNTSPN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacaagctgaatctggtgctgccgccggtaaatacggaggcaactgttgcc
gccgccacagtggcgccgacgccgccattcaaaaccccctcgggcacagacacacacagt
ttgctggggaagcccaagacgagcatcgatgcgctgacagagacgctggagggtctggac
atgggcgacacggaacgcaagcggatcaagatgttcctcagccagaaggagaagatcggc
gagctgtccgacgaggatctggagaagctgggcgagctcggatcgggcaatggcggcgtg
gtgatgaaggtccggcacacgcacacacacctgatcatggccaggaaactgatccatctg
gaggtgaagccggcgatcaagaaacagatcctgcgcgaactgaaagtcctgcacgaatgt
aatttcccgcacattgtcggtttctacggcgccttctacagcgacggcgagatcagtatc
tgcatggagtatatggacggtggatcacttgacctgatcctcaagcgggccggtcgaata
ccagagtccattctcggcaggatcacgctggcggtgctcaagggcttgagctatctgcgc
gacaatcacgccatcatccaccgtgacgtgaagccgagcaatatcctcgtcaatagcagc
ggcgagatcaagatctgtgatttcggcgtctccggtcaactgatcgactcgatggccaac
tcctttgtgggcacccgtagctatatgtcgccggagcgattgcagggcacccactactcc
gtgcagtcggacatctggtcgttgggtctgtcgctggtggagatggccatcggcatgtac
cccatcccgccgccaaacaccgccaccctggagtcgatattcgccgacaatgcggaggag
agcggccagccgacggacgagcccagggcaatggccatcttcgagctgctggattatatt
gtaaacgaaccgccgcccaagctagagcacaagatcttctccaccgagttcaaggacttc
gtggacatctgcctgaagaaacagcccgacgagcgggcagatctcaagaccctgctgagt
catccgtggatacgcaaggcggaattggaggaggtggatatatccggctgggtgtgcaag
acaatggacctgccgccatcgacgccaaagcgtaatacgtcgcccaactag

DBGET integrated database retrieval system