KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1584
Entry
Dmel_CG1584       CDS       T00030                                 

Gene name
Orc6
Definition
(RefSeq) origin recognition complex subunit 6
  KO
K02608  origin recognition complex subunit 6
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dme03032]
    Dmel_CG1584 (Orc6)
DNA replication proteins [BR:dme03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    Dmel_CG1584 (Orc6)
SSDB
Motif
Pfam: ORC6
Other DBs
NCBI-GeneID: 36017
NCBI-ProteinID: NP_477319
FlyBase: FBgn0023180
UniProt: Q9Y1B2
Structure
PDB: 
4XGC

Position
2R
AA seq 257 aa
MTTLIEQLITKMGLREEPNVLEKTTELVRLLELRSTNVPLQINEYGKIVLCADLASCMIG
IAFDKEQALKLSGLRKSQYLNNKRMFEKLLDLNKLASVNDICVQLGLNEVARKAEELMTL
FKGVAATEDMGTDTSHPQYATMAVFQACRLLKKKVSKSKLMPFSNLRPSQFQLLEQQWER
MIAKHHKESKVPSSTDMEGKLKENQNENIKGHEAKKAHKPPPEDYEIWKARMLAKAQAKL
KELEASQSHMDSQLLEA
NT seq 774 nt   +upstreamnt  +downstreamnt
atgactaccttaatagaacagttaattacgaaaatgggcctaagggaggagccaaacgtg
ctagagaaaaccaccgaactagtacgcctcctggaactgcgctccacgaatgtccctctg
cagatcaacgagtacggaaagatagtgctgtgtgcggatctcgcttcctgcatgattggg
atcgctttcgacaaggagcaggcactgaaattgtcaggattgcgaaagagccaatacctc
aacaacaagcggatgttcgagaagctactggacctaaacaaactggctagcgtgaatgac
atctgtgtccagctgggtctcaacgaagttgcccgcaaggcggaagagctaatgactctc
ttcaagggcgtagcggccaccgaggacatgggtaccgacaccagccatcctcagtacgcc
accatggccgtgttccaggcctgccgcctgctcaaaaagaaggtttcgaaatcaaagctc
atgcccttcagtaatttgcgaccctcccagtttcaactgctcgagcagcagtgggaacgc
atgatagctaagcaccacaaggagagcaaagtaccatctagcaccgatatggagggtaaa
cttaaggagaaccagaatgagaatatcaagggtcatgaggcaaaaaaggcacataagccc
ccaccggaggactacgaaatatggaaggcgcgaatgttggccaaggcgcaggccaaattg
aaggaattagaagcatcccaatcgcatatggatagccagcttctcgaggcttag

DBGET integrated database retrieval system