KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1591
Entry
Dmel_CG1591       CDS       T00030                                 

Symbol
REG
Name
(RefSeq) proteasome regulator gamma, isoform B
  KO
K06698  proteasome activator subunit 3 (PA28 gamma)
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03050  Proteasome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    Dmel_CG1591 (REG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:dme03051]
    Dmel_CG1591 (REG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG1591 (REG)
Proteasome [BR:dme03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    Dmel_CG1591 (REG)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG1591 (REG)
SSDB
Motif
Pfam: PA28_beta PA28_alpha
Other DBs
NCBI-GeneID: 32274
NCBI-ProteinID: NP_001259502
FlyBase: FBgn0029133
UniProt: Q9V3P3
Position
X
AA seq 245 aa
MPNDTVVKVQEYKDSLILKAELLITKGFPENIVRLNELLATPIFNERNFEEVHQDLNIPV
LPPLLVKNELEDRDSLPTKRQRVDVIVSGQPVMGLPAGTVPCNKPLCEMIKVVKPIIRKL
VEDSNLLKMWISFMIPKIEDGNNFGVSIQEDTLAEIQTVESEAAAFFDQISRYFLSRAKV
VSKVAKYPHIDDYRRAVVELDEKEYLSLWLVVCEVRNRYSSLHDIVIKNLEKLKKPRSSN
TESLY
NT seq 738 nt   +upstreamnt  +downstreamnt
atgcctaacgacactgtggtaaaggtgcaggagtacaaggactcgttgatcctcaaggca
gagctgctaatcaccaaggggttcccggagaatatcgtccggctgaacgagctgctggcc
acgccgatcttcaacgagcgcaacttcgaagaagtgcaccaggacctcaacatcccggtc
ctgccgcctctcctggttaaaaacgagttggaggatcgtgacagtctgcccaccaagcgc
cagcgcgtggatgtcatcgtctctgggcagcctgtcatgggtctgcccgccggtacagtg
ccgtgcaacaagccgctctgcgagatgatcaaggtcgtcaagcctatcatcaggaagctt
gtggaggattccaatctacttaagatgtggatctcctttatgatacccaagatcgaggat
ggcaacaactttggcgtctccattcaagaggacacgcttgccgaaattcaaactgtggaa
tccgaggcggccgccttctttgaccagatatcgcgctatttcttgtcgcgcgccaaggtg
gtgtccaaggtggccaagtatccgcacatcgatgattatcggcgcgcagtcgtcgaactt
gacgagaaggagtacctcagcttgtggctggtcgtttgtgaggtccgcaatcgctactcc
tcgctgcacgacattgttattaagaacctcgagaagctaaagaagccgcgctcctcaaat
accgaaagcctgtattag

DBGET integrated database retrieval system