KEGG   Drosophila melanogaster (fruit fly): Dmel_CG16747
Entry
Dmel_CG16747      CDS       T00030                                 

Gene name
Oda
Definition
(RefSeq) ornithine decarboxylase antizyme, isoform A
  KO
K16548  ornithine decarboxylase antizyme 1
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG16747 (Oda)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     Dmel_CG16747 (Oda)
SSDB
Motif
Pfam: ODC_AZ Elicitin
Other DBs
NCBI-GeneID: 36307
NCBI-ProteinID: NP_725103
FlyBase: FBgn0014184
UniProt: P54361
Position
2R
AA seq 254 aa
MPSNMNNKLDPVFSSGFVRREFNDSGIADGKLRTISTSSCATTMSSESYRISLGVGPLWW
SDVPVHHRTDHDRASLLTGYSRKSSVDSAGGSLYEASSRASSLSSSQSDCSDLESQPDIH
SLCSDDDCQEVLRQILQHDQPVQITIKLHVTEDQYTNWNTILNPVNNLLYVALPKDLPPA
GSKQTFISLLEFAEEKLEVDGIVMVMPKDQPDRARLIEAFLFMGFEPLSRKAPQAPPAAI
NDNENYYFLYSIEE
NT seq 765 nt   +upstreamnt  +downstreamnt
atgccatccaatatgaataataaactcgacccagtgtttagtagtggcttcgttagaaga
gaatttaatgacagcggaattgccgacggcaagctccgcaccatctcgacttcgtcttgc
gccacgaccatgtcctcggagtcctaccgcatctctctcggcgtagggcctctgtggtgg
tccgatgtccctgtccaccacagaacagatcacgatagggcatcgctcttgacgggctac
agccgtaagtcttcggtcgactcggctggtggcagcctgtacgaggccagctcccgggcg
tcgtcgttgtcgtcctcccagtcggattgctccgacttggagtcgcagcccgacatccac
tcgctgtgctcggacgatgactgccaggaagtgctgcgccagatcttgcagcacgaccag
ccggtgcagatcaccatcaagctgcatgtcaccgaggaccagtacaccaattggaatacg
attctgaacccagtcaacaacttgttgtatgtcgctctaccgaaggaccttcctccggcc
ggctccaagcagaccttcatctcgcttctggagttcgccgaggagaagctggaggtggac
ggcatcgttatggtaatgcctaaagatcagccggatcgagctcgcctcatcgaggcgttc
ctcttcatgggcttcgagccgctgtccaggaaggcaccgcaggcaccgccggctgccatt
aacgacaacgagaactactacttcctctacagcatcgaggagtag

DBGET integrated database retrieval system