KEGG   Drosophila melanogaster (fruit fly): Dmel_CG16799Help
Entry
Dmel_CG16799      CDS       T00030                                 

Gene name
CG16799
Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dmel_CG16799 (CG16799)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lys Phage_antiter_Q
Motif
Other DBs
NCBI-GeneID: 37340
NCBI-ProteinID: NP_001286641
FlyBase: FBgn0034538
UniProt: A1ZBX6
Position
2R
AA seq 179 aa AA seqDB search
MCLKARHPKTKRDLMNMKTFCLWIVPVLILLQLGIEQVESKKYQRCELTRVLVENYNFDK
TFISNWICLVEHESYLDTTKVTKKGNESKNYGLFQINSKDYCSEGRKGGQCNMKCEDFSN
DDISDDIACARMIQEREGFKYWKGWDRFCRNPQNLPNLRVACNLRSLSPVRSPRGFLTG
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttgaaagcacgccatcccaaaacgaaacgcgatctgatgaacatgaaaactttt
tgtttatggatagttccagtgctgatcctgctgcagctgggaatcgagcaagtggagtcc
aaaaaatatcagcgctgcgaactcacaagagttttggtggagaactacaacttcgacaag
accttcatttccaactggatctgtttggtggagcacgaaagttacttggacaccaccaaa
gtaacgaaaaagggaaacgaaagcaagaactatggcctctttcagatcaacagcaaggat
tattgcagcgaaggacgaaaaggagggcagtgcaatatgaaatgtgaagacttctccaat
gacgacatcagtgacgacatcgcctgcgccagaatgatccaggaacgcgagggcttcaaa
tactggaagggctgggatcgcttctgccgcaatccacagaatctgcccaatctccgcgtg
gcctgcaacctgcgtagcctgtctccagtgcgatcacctcgtggattcttaacgggctga

DBGET integrated database retrieval system