KEGG   Drosophila melanogaster (fruit fly): Dmel_CG16858
Entry
Dmel_CG16858      CDS       T00030                                 

Symbol
vkg
Name
(RefSeq) viking, isoform B
  KO
K06237  collagen type IV alpha
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    Dmel_CG16858 (vkg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG16858 (vkg)
   00536 Glycosaminoglycan binding proteins [BR:dme00536]
    Dmel_CG16858 (vkg)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   Dmel_CG16858 (vkg)
Glycosaminoglycan binding proteins [BR:dme00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   Dmel_CG16858 (vkg)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 33726
NCBI-ProteinID: NP_001260071
FlyBase: FBgn0016075
UniProt: Q9VMV5
Position
2L:complement(5012144..5028191)
AA seq 1940 aa
MLPRDLRHLSGLLGVVYLLGSLVSVTLADGKICNTTLCDCKGIKGRMGAPGPIGVPGLEG
PAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRG
IDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGG
VGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDS
LSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKD
GEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLP
GPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYG
FIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGD
KGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRG
QEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDG
KAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGR
DGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDN
TGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQ
GAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLA
GRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKG
EVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNG
RQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSG
IKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGL
KGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGL
DGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERG
EQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGD
EGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHN
GRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPG
KNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGE
EGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGP
QGEPAPAPPAPKSRGFIFARHSQSVHVPQCPANTNLLWEGYSLSGNVAASRAVGQDLGQS
GSCMMRFTTMPYMLCDITNVCHFAQNNDDSLWLSTAEPMPMTMTPIQGRDLMKYISRCVV
CETTTRIIALHSQSMSIPDCPGGWEEMWTGYSYFMSTLDNVGGVGQNLVSPGSCLEEFRA
QPVIECHGHGRCNYYDALASFWLTVIEEQDQFVQPRQQTLKADFTSKISRCTVCRRRGNS
FVARTAKSRADASSGFTDGSASSNPSGSLKTDGNYRANWQSGRSSSPGSQSSPGSSSGSW
SSGSNAGAYPGSNAGAYSGSNAGAYPGSNAGAYPGSNAAWQSRTNAGSSWHSGPVAGSVS
NPGSYSSWSTGSSPGSNPESNAGSTRSSWITRSRGPSNYLNGRYQQRVHPSNLQAYDEYA
RHGGNTRQYNRRPREDTTAP
NT seq 5823 nt   +upstreamnt  +downstreamnt
atgttacccagagatctaaggcatctctcgggtcttctgggcgtcgtttatctgttgggc
agcctggtttccgttaccttggcggatggaaagatctgcaacacaacgctatgcgactgc
aaaggaatcaagggacgcatgggcgccccaggacccatcggagttcccggcttggaagga
cctgccggtgatataggaccacctggacgagcaggaccactcggcgagaagggagatgtc
ggcgagtatggcgaacaaggcgagaaaggacatcgcggcgatatcggacctaaaggtgaa
atgggttaccctggaattatgggtaaaagcggtgagcccggaacacctggaccacgtgga
atcgatggctgcgacggacggcctggtatgcagggtcccagcggagcacctggccagaac
ggagttcgcggtccgccgggaaagcccggtcagcagggtccacctggagaggctggcgag
ggcggcatcaactccaagggcaccaagggcaatcggggcgagactggacagcctggcggt
gtgggaccgcccggattcgatggcgatcgcggtagcaagggtgacactggatatgctggc
ctaactggcgagaagggagatccaggactgcctggacccaagggtgacactggcgccgtt
tcggagctgccatactcactgattggaccacctggcgccaagggtgagccaggtgacagc
ctatccggagtgctgaagccagacgacaccttgaagggttacaagggatatgtgggactc
cagggtgatgaggggccacagggaccgaccggcgaacaaggcgccgttggacgtaatgga
ttgcccggtgcaagaggtgagatcggtggacccggagagcgcggcaagcccggtaaggat
ggtgaacccggtcgattcggagacaagggcatgaagggtgcgcccggctggactggagct
gatggattggacggaagcccaggagagcgtggagaggatggattcaccggcatgcccggt
gttcaaggcggcgctggtcccccaggaatttacgatcctagcctcacgaaatcgctgccc
ggcccgattggatcgcagggagacatcggaccgcccggagaacaaggtccaccaggtctg
cccggcaaacctggacgccgcggacccatcggtctagctggtcagtcaggagatcccggc
ttaaacggcagtcgcggaccgcctggtcgtagtgagcgcggtgaggccggagactatgga
ttcattggaccaccgggaccgcagggtccccctggcgaagctggtctacccggccgatac
ggactgcacggagaacctggacaaaatgtggtcggaccgaagggcgagcctggcctaaat
ggacaacctggtttggagggctaccgcggtgatcgcggagaggtcggtttgcccggtgac
aagggtctgcccggcgagggctacaacatcgttggtcctcctggttcccagggaccgccc
ggtttccgtggacttcccggtgacgatggttataacggactacgtggactgcccggtgag
aagggattgcgcggtgacgactgccccgtgtgcaatgccggaccccgtggaccccgtggc
caggagggcgacaccggctacccgggtagccatggaaaccgtggagctatcggcctcact
ggaccgcgtggcgtacagggcttgcaaggtaaccccggacgggctggtcacaaaggtctg
cccggtccagcgggtattcccggcgagccaggcaaagttggagcagccggacccgatgga
aaggcgatcgaagtgggctccttaaggaaaggcgaaatcggtgacaccggcgacagtgga
catcgcggagatacgggtgacgacggtgaaaagggtcgggatggatccgatggtagcaaa
ggtgagcgcggagaaaccggacaacgcggtgactacggcgatgccggttaccaaggacgc
gatggtgaaccaggacgcgatggtcgtgatggagctcccggtagaaacgccaccactccc
aaggtctacttgatcggcgagccgggatatgacggaataaagggcgagcgcggcgatgat
ggtgataccggtttcaagggcgtcaagggtgagccgaatcccggtcagatctacgacaac
actggtgagcctggcgaggatggttataccggaccgaagggcgttaagggagccaagggc
gagcaaggagctattggacttcgtggcgaaattggtgaccgtggcccggctggcgaagtt
attcccggacccgtgggtgccaagggttatcccggcccaactggcgattacggacagcag
ggagctcccggactgcctggtcgcgatggtgaacctggtttggatggaggcattggatac
aagggacaacgcggtgtacctggtcaggaggtgattcagggcgagattgggccaccgggt
cgatcaggcattaagggcttccccggtgatgtcggcgcacccggccaatacggactcgcc
ggacgcccaggaccgaagggtgtgaagggcgagcaaggacccgatggcgcagttggacaa
acaggactgcctggcaacaagggccagcgcggtgacttcctggttggtccgcccggacca
aagggtcagcccggacgcaatggtcgccaggcaccgcacggcgccaaggggcagaaggga
gaggttggctcgctgggccagaatggacagaacggcgccaagggcagcatcggtttctct
ggccgtcgtggactcctcggcaatgcgggtctgcagggattgcctggtagtcctggcata
cccggtcttccaggaatgattggcgagatcggagagcgtggtgagattggatacaatgga
cggcagggtgacatcggtcctcgtggtcccaacggcgagttcggacctaaaggtctctct
ggtgatgatggaccggatggctatcccggagctaacggccttcccggacgcaagggtgag
acaggaaatcctggattcccaggacgtccaggcgcgaagggcgtggccgcctacagtggc
ataaagggtgatgacggagaatccggcttgaccggacccatcggataccccggagctccc
ggagcgaagggacagcgtggacccgttggagattcgcaaccagctctcgatggagttgct
ggacgcaagggagaagtaggcagtccgggacccaatggacttcccggtcgccatggactg
aagggacagcgaggagatcgcggtctccccggccaacagggtagaccaggagagccagga
gccaagggattgggcggctatcctggacgcaatggaattaatggcctgaagggcgccact
ggttttcctggaccccagggacccaaaggtcctcagggcgagagcggagttgtgggcttg
gatggtcgaaatggtcagattggtgatcaaggaccacgcggattgattggtgagcaggga
gagcagggtgagcagggtgacgaaggtgaagtcggtattccgggtcgcttggagaacctg
cgggatcggagcttctatcgcggcttcaccggagatcaaggtctacagggtgaacgtggc
gagcagggtgatatgggaccaattggatttattggacctcccggcgccaagggcgaacgc
ggtgacattggctatgctggacaacttggattcgatggagctgaaggccttaagggcttc
cagggtgaccaaggaccacgaggtcctccgggcataacattgcccgccgagaagggtgac
gaaggcgttgctggactcgatggacgagcaggacgtccgggacactttggccagaaggga
gcacccggaccaccgggagagaatggacccaacggtgcgatcggacaccgtggaccccaa
atccaggggccacctggacctcagggagatgtcggctttcccggagcaccgggacacaat
ggtcgtcatggactaatcggaccaaagggagagcttggcgacatgggtcgccagggtgag
cgcggtgaatctggatatgccattgtcggcaggcagggcgacatcggagatatcggcttc
cagggcgaacctggctgggatggcgccaagggcgagcaaggatatcccggacttccgggt
aagaacggaagggtgggtgccccaggaccacggggacccactggcgacgccggctggggt
ggaatcgatggcatggacggactcgttggccccaagggtcaaccaggtgtaacatactcc
tactccatggcccgacccggagatcgtggtgagcccggacttgatgggttccagggcgag
gaaggcgatggtggagcaccaggacttattggattccaaggacagagaggtgccgtcgga
tatcgcggtgaccagggcgaggtgggctacaccggagccgatggaccgcagggacaacgt
ggtgacaagggttatatgggcttgaccggagcacccggcttgcgtggtctgcccggacca
caaggtgaaccagcgccagcaccgccggcacccaagagccgcggattcatcttcgcccgc
cactcgcagtccgtccacgtacctcagtgtccggccaacacgaatctgctatgggagggc
tactcactgtcgggcaacgtggccgccagcagagcggtgggtcaggatctcggtcagtcc
ggctcctgtatgatgcggtttacaaccatgccgtacatgctgtgcgacatcaccaacgtc
tgccactttgcccagaacaacgatgacagtctctggctgtccaccgccgaacccatgcca
atgaccatgacgcccatccagggcagggacctcatgaagtacatttcgcgttgcgttgtg
tgcgaaacgacgaccaggatcatcgccctccactcgcaatccatgtccattccggactgt
ccaggcggctgggaggagatgtggaccggctacagttacttcatgagcaccttggacaac
gtcggtggcgttgggcagaacctcgtctccccgggctcttgcttggaggagttccgcgcc
cagccggtgatcgagtgccatggccatggacgctgcaactactacgatgcgctggcctcc
ttctggttaaccgtcatcgaggagcaggatcagttcgtccagccgcgccagcagacgcta
aaggcggattttaccagcaagataagcaggtgcacggtttgccgtcgtcgaggcaacagc
tttgtggctcgcactgcaaagtccagggcagatgcgtcttccggtttcacagatggttct
gcctcgagtaatccttcgggcagtttgaaaacagatggcaattacagggcaaactggcaa
tccggccggtcttccagtcctggctctcagtccagtcctggttccagctccggatcctgg
tcatctggatccaatgccggagcttatcctggctccaatgccggagcttattctggctcc
aatgccggagcttatcctggctccaatgccggagcttatcctggctccaacgccgcctgg
caatcgaggaccaatgctggatccagctggcattccggacccgtagcaggatcggtctcc
aatccgggatcgtactctagctggtccacgggctccagtcctggttccaatcccgaatct
aacgccgggtccacgcgctcctcttggatcacgcgcagtcgcggcccatcaaactatctg
aacggaaggtaccagcaaagggttcacccgagcaacctgcaggcctacgatgagtatgct
cgccatggtggcaatacccgccagtacaaccgacgcccacgcgaggacaccaccgccccc
tag

DBGET integrated database retrieval system