KEGG   Drosophila melanogaster (fruit fly): Dmel_CG16910Help
Entry
Dmel_CG16910      CDS       T00030                                 

Gene name
key
Definition
(RefSeq) kenny, isoform A
  KO
K20700  NF-kappa-B essential modulator
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG16910 (key)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CC2-LZ zf-C2H2 zf-met Zn-C2H2_12 zf-C2H2_4 zf-C2HC_2 zf-C2H2_6 zf-C2HE zf-C2H2_9 Ndr zf-C2H2_jaz
Motif
Other DBs
NCBI-GeneID: 37967
NCBI-ProteinID: NP_523856
FlyBase: FBgn0041205
UniProt: Q9GYV5
Position
2R
AA seq 387 aa AA seqDB search
MSDEESFVILGSSPCSSLMPDSSLRSDVCGNAQEAKETVASTSTQPPTVNCIPVSITASQ
QQHKSLDSGSSQQQSLATSFIMGEIQSDVLKNSVYSQFPSLCSLQGSAEEVVKLQNMMTE
YLALKSTLDKVNQTMLNYHNLTQQWRQEAADREHQYKEHVKECQAQIAILRVENQELKRD
LETKIEQIEGVHTIRLKEQDELRKSVSEKQSLIDNMRVEIDKLKQLNHSFEFVPEYATES
KSQELIKKMQLDINELKARDIQKQEVIKGLQIQNDIYRRDFEMERADREKNAGEKDQYLM
DLRSLQRRNQELIEALAESHKASKACSTASPLSSSRSNLREEQRPILDPTGASSRTSDTT
LRCPICSKSFNALSVLQSHVNDCLDKN
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgaagagtcattcgttatcttgggtagctcgccgtgctcctcgctcatgccg
gacagttccttgcggtccgacgtatgtggtaacgcgcaggaggcgaaggaaaccgttgcc
tctacgagcactcagccgccaacagtgaactgtattccagtcagcatcactgcatcgcag
cagcagcacaaatcgctggattccggatcttcccagcaacaatccctggcgaccagcttc
attatgggagaaattcaatccgatgtcctgaagaacagtgtttattcgcagtttcccagc
ctctgctcgttgcagggctccgcagaggaagtagttaagctgcagaacatgatgaccgag
tacctcgcgctaaagagcacacttgacaaggtcaaccaaaccatgctgaactaccacaac
ctgactcaacaatggcgccaggaagccgccgaccgagaacaccagtacaaggagcatgtg
aaagagtgccaagcgcaaatcgcgatccttcgcgtggaaaaccaagagctgaagagggac
ctagagacgaaaatcgagcagattgaaggggttcataccatcaggctaaaggagcaggat
gagcttcgtaagagcgtatctgagaaacagtccctgatcgacaacatgcgcgtggagatt
gacaaactgaaacagctaaatcactcgtttgagttcgtaccagagtatgcaaccgaatca
aaatcccaggagctgataaagaaaatgcagctggatattaacgagctgaaggccagggac
atccagaagcaggaggtgatcaaaggtctacagatccaaaacgatatctaccgcagggac
tttgaaatggagcgggcagatcgcgagaagaatgccggagagaaagatcagtatcttatg
gacttgcgatcattgcagaggaggaaccaggagcttatcgaagctctggccgagtcccac
aaggcaagcaaggcgtgctcgaccgcttctccgctgagttcaagcagaagcaatttgcga
gaggagcagagaccaattctcgacccaacaggcgcctcatcccggacttcagacaccact
ttgcgatgtccgatctgttcaaagtcctttaacgccttaagcgtgcttcagagtcacgtt
aacgattgtttggataaaaactaa

DBGET integrated database retrieval system