KEGG   Drosophila melanogaster (fruit fly): Dmel_CG16995
Entry
Dmel_CG16995      CDS       T00030                                 

Gene name
CG16995
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: CAP
Other DBs
NCBI-GeneID: 33413
NCBI-ProteinID: NP_608668
FlyBase: FBgn0031412
UniProt: Q9VQA7
Position
2L
AA seq 146 aa
MSAQQFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSGYGEN
IYMASGGNLKGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFAKSGST
IYVVCNYNPPGNYNNLFRENVAPPMQ
NT seq 441 nt   +upstreamnt  +downstreamnt
atgagcgctcaacaatttgagcaagaagttcttcaagcccacaatttatatcgggccaag
catggtgctcaacccttgactttgagtcccaaactgaatcgattggccacggaatgggcc
aattatttgctgtccagaaatcgcatggaacatcgacagaacagtggatatggtgagaac
atttacatggcctccgggggaaatctgaaaggtgccgatgccgtcagatcctggtacgaa
gagattcgacagtacaattggaattctccgtcgtttcaaggtaacaccggccatttcact
caggtggtctggaagagctccaccgagctaggcgtgggttttgcgaagagtggcagtacc
atctatgttgtgtgcaactacaatccccctggcaactacaacaacttgttcagggagaat
gtcgcacccccaatgcaatag

DBGET integrated database retrieval system