KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17191
Entry
Dmel_CG17191      CDS       T00030                                 
Symbol
CG17191
Name
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Lipase DUF900 Abhydrolase_1
Other DBs
NCBI-GeneID: 43249
NCBI-ProteinID: NP_651523
FlyBase: FBgn0039473
UniProt: Q9VB91
Position
3R
AA seq 337 aa
MRVFIALAALLATVSALPIEERVNGENGWYVPQIDGSFEWMDKQDAEELLNRNSLIETRS
NDVSFYLYTKHNPTVGKEIRADASSIEDSHFDKNQGTRFVIHGWNGRYTDGMNVKITRAW
LSKGDYNVIVVNWDRAQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSL
GAHVAGYAGKQVGGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNGGEKGFL
KPIGKGTFYPNGGRNQPGCGSDIGGTCAHGRSVTYYVEAVTEDNFGTIKCHDYQAALANE
CGSTYSGVRMGAVTNAYMVDGDFYVPVNGQAPFGKIE
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgagagtgttcatagctctagcggctttgttggcaacagtaagtgctcttcccattgag
gaacgtgtcaatggtgaaaatggttggtatgtgcctcagatagacggcagtttcgagtgg
atggacaaacaggatgccgaggagctcttaaatagaaattcactcatcgaaacacgttcc
aatgacgtgtccttttacctgtacaccaaacataacccaaccgtgggaaaggaaatcagg
gctgatgcttcatcaatcgaagactctcatttcgataagaaccagggtactcgtttcgta
atccacgggtggaatggtcgctacactgatggcatgaacgtcaagatcacccgagcctgg
ctttcgaagggagactacaacgtgatcgttgttaactgggatcgtgcccagtccgtggac
tatatctcatcggtgcgagctgttcctggagctggagccaaagtgggagaaatgattgaa
tatctgcatgaacaccatcatttgtccatggagagcctggaagtaatcggacacagtttg
ggtgcccatgtggctggctatgctggaaagcaggtgggcggcaaaagggttcacacgatt
gtcggtctggatcctgccatgcctctttttgcctacgataagcctgacaagcgactgtcc
accgaagatgccttctatgtcgagtctattcagaccaatgggggtgaaaagggtttccta
aaacccattggcaaaggcactttctatccgaatggaggaagaaatcaaccaggttgcggt
tcagacatcggaggaacctgcgcccacggacgatccgtaacgtattacgtggaggcagtc
actgaggataactttggaacgatcaagtgtcacgactaccaggctgcgttggccaacgag
tgcggaagcacctacagtggagttcgcatgggagctgttaccaacgcctacatggtcgac
ggtgacttctatgtgcccgtaaacggacaggcccccttcggaaagatcgaatag

DBGET integrated database retrieval system