KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17237
Entry
Dmel_CG17237      CDS       T00030                                 

Symbol
CG17237
Name
(RefSeq) uncharacterized protein
  KO
K12751  myosin light chain 6
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dme04812]
    Dmel_CG17237 (CG17237)
   04147 Exosome [BR:dme04147]
    Dmel_CG17237 (CG17237)
Cytoskeleton proteins [BR:dme04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     Dmel_CG17237 (CG17237)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dmel_CG17237 (CG17237)
  Exosomal proteins of bladder cancer cells
   Dmel_CG17237 (CG17237)
SSDB
Motif
Pfam: EF-hand_6 EF-hand_7 EF-hand_9
Other DBs
NCBI-GeneID: 33411
NCBI-ProteinID: NP_608666
FlyBase: FBgn0031410
UniProt: Q9VQA5
Position
2L
AA seq 192 aa
MMSRKGNQLHPSSIRPSSTTPDCNQKRRGDMTAPPPNPKPEKSRIMEMHAIFLGHDTRGD
NKISIRHLGHCLRAMGATPTEAMVSKHVRQYEASTMQRICFDEVMGIYSSLGKHGGMLSP
KKKQIEADQFVSSLRVFDTDKSGWIPAIRLRRILTKTGECMGSMEVDELLQGRINKDGLV
DYKKLVQDIIYG
NT seq 579 nt   +upstreamnt  +downstreamnt
atgatgtccaggaaaggcaatcaactccacccgtcatcaatccgtccatcatcgaccaca
ccggactgcaatcagaagcggcgaggcgacatgacagctcctcctccgaacccaaagcca
gagaaaagccgcatcatggagatgcatgcgatttttctggggcacgacactcgcggcgac
aataagatatccatccggcacctgggccactgtctgcgtgcgatgggcgccactcccacg
gaggcgatggtcagcaaacatgtccgccagtacgaggcctccaccatgcagcgcatatgc
ttcgatgaggtcatgggcatctactccagtcttggcaagcacggcggcatgttgtctccc
aagaaaaaacagatcgaggcggaccagttcgtatccagtctaagggtctttgatacggat
aagtccggttggattcccgccatcagactccggcgcattctaaccaagaccggggagtgc
atgggcagcatggaagtggacgagctgctccagggtaggatcaacaaagacggcttggtc
gactacaagaagctggttcaagacattatctatgggtaa

DBGET integrated database retrieval system