KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17245
Entry
Dmel_CG17245      CDS       T00030                                 

Symbol
PlexB
Name
(RefSeq) plexin B, isoform B
  KO
K06821  plexin B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Plexin_cytopl Sema TIG TIG_plexin TIG_2 PSI PSI_integrin
Other DBs
NCBI-GeneID: 43766
NCBI-ProteinID: NP_001245400
FlyBase: FBgn0025740
UniProt: Q9V4A7 H9XVL5
Position
4
AA seq 2051 aa
MLRKELYCANIIHVLHVLCIIIILGSQHYCVNCIEELPAQALSPLNDIVAQFNLPSIPVQ
STASSYGNRSIGNNIESVRDSQSKNYFTHMSFDFMHNVLFAGATNKILKLNENLRVLAEA
VTGPLHDSPQCHAGGCPEDIETSLVNNFNKILVVSYAHDGILIACGSIRQGACEIYSLPR
FPATPQFFAVPLAANDENASTYAFVGPARYAWKEEDILYVGTTFTNVGDYRHDVPAISSR
RLDDLNYAEFSIQQSIINIDVKYRDHFLVDYIYGFNSSEYAYFIIVQKKSHLADEAGYVT
RLARICITDPNYDSYTEITVQCTATENNVDYNIVRDAKVTPASHKLAQKMGIKKDDHVLV
TVFSPSREISNQPESKSAMCIYSIKDIEDMFIENIHLCFNGTTKDRNLGYISGTINDGRC
PIVGSLGNIYNFCSVGLKISGVSPITAHALFHFDNVSVTSVTATSTTDQQHSLAFLGTNM
GVIKKVLLSGQSPGEYEEIVVDAGNRILPNTMMSPKKDFLYVLSQRKITKLRIEHCSVYT
NCSACLESRDPFCGWCSLEKRCTVRSTCQRDTSASRWLSLGSGQQCIEFESIIPEKIPIS
ELSHLHLIIRTLPEPFNAKYRCVFGNSTPIDAEILENGLGCATPPLDERPLIPTNTDHIL
VPLSVRSSETNKDFVSRNFAFFDCSHHGNCQECLQSSWGCNWCIFDNKCVHKSLQCRNIE
NAVSTVGHCPHLKKNRPEILLPVRVPIEIRLEIENLPKPKSAHAGFLCTIHIEAAQMLLP
AHVESNKIVVCEKTPYFYEINTHEYQAKVVVTWNFQHYVDTAIVTLYKCDVLGSHREHPD
CSLCVTRDPKYKCAWCSNSCVYNETCIADKNSISSGSKSAIENECPLPRIDIIKPLSGPV
EGGTLITIEGSNLGIREEDVRGKIFIGSVPCELENYQISVKIECRTGASLYEMSAPIKVA
NDAGFTESSVQFHFKNVLLTGLYPTIGPRSGGTQLSLIGKFLNIGSTMRAFLDEYECHID
VTQASSSQVSCTTSEATQPEPIRSLHLVIDGANRTLECQISTPSITNTNPTRSNFGSYQL
RSLPRQPCSIFNYTQDPRIMQIKPLRSFKSGGRVLTVHGIYLNSIQKPELEVFYDNERVN
KTSCVVINSNQMECPSPPVNYKFETFKKTNRKMDTELHLQNSSFQTETRYKNEYDRKKRR
ADFGDTFRLYTNAGSSANYFVNNNMDVTTFVKVHETQLNLQLSFVMDNVQLVRNLNKYFH
DIRSTIVYLADPKYLPFPNDGVKLYKGDSLVIEGELLNLAADEYDVNVTIGTSQCNITSL
ALNQLLCIPPEQQPLPTDENGVDQSTDLPLVVVKVGRNLRFVIGYLKYDLNKPYVFSHAL
LVGILTVALLVVVFVIVLIIFRRKSTQAEREYKRIQIQMITLESNVRSECKQAFAELQTD
MTDLTADLESTGIPTLDHVNYIMKVFFPGVSDHPILNSPKFREGSPQTNYDAAMVQFEQL
IGNKYFLLMFIETLEAQRSSFSIRDRVNVASLIMVVLMNKMEYATEILKSLLLRLIDKSL
ASKHPQLMLRRTESVVEKMLTNYLAICMYDYLKEYAGSNLFLLFKAIKHQIEKGLVDAIT
NDARYSLSEERLLHEQVTHSVVILHILQDDLDEKVQCRVNDWDTISQVKLKILDAIFKNT
PFSMRPSVNEVDLEWRHGRGGHLTLQDEDLTTKTVNGWKRLNTLAHYGVKESAVMSLIAR
QNDNYHIPYSKNQNSAPYHNFYFINNSQSHIIINNDIESGLQQPRVYHLVKPNIPDHYMN
IKNSVLSGGSPAFQSHVVNNCNDRVNKTIPEVYLTRLLATKGTIQKFVDDFFSIILTVNE
ELPPAVKWLFDLLDEAARRHDIADTDIVHAWKSNCLPLRFWVNFIKNPDFIFDVNKTYSV
DSCLSVIAQTFMDACSTSEHRLGKDSPSNKLLFAKDIPNYRIMVKEFYRDVSRLPQISDQ
EMSTAMQQLSVRQNEEFDTISALKELYIYITKYKDQIMESLETDINCRKMHLSRKLGNVA
ATLDGDCTSNC
NT seq 6156 nt   +upstreamnt  +downstreamnt
atgttgcgaaaggaattgtattgtgcaaacattatacatgttttacatgtactgtgtatt
attatcatactcggttctcagcattattgcgttaactgcattgaagaactgccggctcag
gcgttatctcccttaaatgacatagtcgcccagtttaacttgccatcaataccagttcaa
tcaacagcttccagctatggcaatcgatcaattggaaacaatatagaaagtgttagagac
tctcaatctaaaaattattttactcacatgagcttcgactttatgcacaatgttttgttt
gcgggtgctacaaataaaatacttaaacttaacgaaaaccttcgagtgctggccgaggct
gttactgggccgttacatgattccccgcaatgtcacgctggaggctgtccggaagatatt
gagacatcgcttgtcaataacttcaacaaaattctagtagtaagctacgctcacgatggt
attctcatagcgtgtggaagcattcgacaaggagcctgcgaaatttacagcctgccacgt
tttccggcaacgccccagttttttgcagttccattggctgctaacgatgaaaacgcgtct
acatatgcatttgtaggtccggcgagatatgcgtggaaagaagaggatattttatatgtg
gggacaacatttacgaatgttggtgattatcgtcatgacgtgccagccatttcgtcccgc
cgacttgatgatttaaactatgctgaattttcaatacagcagtcaattataaatatcgat
gtaaaatatcgggatcattttctagtcgattatatttacggctttaattcttctgaatat
gcgtacttcataattgttcaaaaaaaatcacatttagctgatgaggccggttatgtaaca
cgcttggcacgcatttgcattacagatcctaattacgacagctatactgaaataactgtt
caatgcactgcaactgaaaacaatgttgactacaatattgtaagggatgcgaaagtaact
ccagccagccacaaattggcgcaaaaaatgggcataaaaaaagacgatcacgttttagta
acggttttttcgccctcaagagaaataagtaatcagccagaaagtaagtctgctatgtgt
atatatagcattaaagatattgaagacatgttcattgaaaatatccatctgtgttttaac
ggaaccacaaaagatcgaaatttgggctatatatccggcaccattaatgatggcagatgt
ccaatagttggttcgctcggtaacatttacaacttttgctctgtgggacttaaaataagc
ggagtatccccaatcactgcacacgcactttttcattttgataatgtttcagttacgtca
gtcacagcaacttcaacgactgatcagcagcattctcttgcatttcttggaacgaacatg
ggagtaatcaaaaaagttttattatctggccaaagtccgggcgagtacgaggaaatagtt
gtggatgctggaaatcgtatactaccaaatacaatgatgtcgccaaaaaaagattttctt
tacgtactttctcaacgaaaaataactaagcttagaatcgaacactgttctgtgtacacg
aattgttccgcttgcttagagtctcgggatcctttttgtggatggtgttccttggagaag
cggtgcactgtacgatcaacatgccagcgagatacatctgcgtcgagatggctttcatta
ggtagtggacagcaatgcatagaatttgaatctattatcccagagaaaataccaatttct
gaattatcgcacctgcatttaataattcgaactttgcccgaaccttttaatgcaaaatac
cgatgtgtttttggaaattccacccccattgatgccgaaattctggaaaacggactcgga
tgtgctactcccccattagatgaaagaccattaataccaacaaacactgatcatattttg
gtgccattgtcagtaagaagttcggagacaaataaggattttgtatcaaggaattttgct
ttttttgactgctcacatcatggaaattgccaggagtgtctacaaagttcctggggttgc
aactggtgtatttttgataataagtgcgttcacaagtctttgcaatgccgtaacatagaa
aatgctgtaagtactgttggtcactgcccccacttaaaaaaaaatcgtccggaaatactt
ctacccgtaagagtgccaatagaaattcggctagagattgaaaatttaccaaaacccaag
agcgcacatgctggttttttatgtacaatacatattgaagctgctcagatgctactccct
gctcacgttgagtcaaataaaattgtagtttgcgaaaaaacaccatatttctacgagatt
aatacacatgaatatcaggcgaaggttgtagttacatggaacttccagcattatgtggac
accgcaattgttacattatacaagtgtgacgtgttgggctcccatcgggaacaccctgat
tgcagtttgtgcgtaactcgagatccaaaatataaatgtgcttggtgcagcaactcatgt
gtatataatgaaacttgcatagctgataaaaattctatcagctcaggatctaaatccgct
atagaaaacgagtgcccattaccacggattgatattattaaaccattatctgggccagtc
gagggtggaactcttattacaattgaaggaagtaatttgggcataagggaggaagatgtt
cgtggcaaaatatttattggttctgtgccttgtgaactagaaaattatcaaatatcggta
aaaattgaatgccggactggagcatcactgtacgaaatgtctgcacccataaaagttgca
aatgatgcagggtttactgaatcaagtgttcagtttcattttaagaatgtgctgttaaca
ggtttatatcccacaattggccctaggtcgggagggacacaattgtctttaattgggaag
tttttgaacattggctcaactatgcgagcatttttagatgagtatgagtgtcatatagat
gttacacaagcttcatcatcccaagttagttgtactacatcagaagcgacccaacctgaa
ccaatacggtcccttcatctagttattgatggtgcgaacagaacgctagaatgccagatc
tcaaccccaagcattaccaatacaaatccgactcgaagtaattttggttcttatcaactc
cgttcgctaccacggcaaccctgctctatttttaactatacacaggacccgcgtataatg
caaattaagccattgcgtagttttaaaagtggtggtcgagtcctcaccgttcatggaata
tatcttaattccatccaaaaacctgaactagaagtgttttatgacaatgaaagagtaaat
aaaacatcttgtgtggtgatcaactctaatcaaatggaatgtccatctcctcctgtaaat
tacaaatttgagacttttaaaaagacgaacagaaagatggatactgaattgcacttacaa
aattcttcgtttcaaactgaaaccaggtataaaaatgaatatgatagaaaaaagcggcga
gccgactttggagacacttttcgcttatacacaaatgcaggatcttcagccaactatttt
gttaacaataatatggacgtcaccacattcgttaaggttcatgaaactcaattaaactta
caactaagttttgtaatggacaatgtacaactagttcgaaacttgaataaatattttcat
gacataaggagcactattgtctatttagcagacccaaaatatttgccatttcccaacgac
ggcgttaaactctacaagggtgacagcttggtcatagaaggcgagctattaaacttggca
gctgatgagtacgatgtaaatgtaactattggaacttcccaatgcaatattaccagcctg
gcacttaaccaacttttatgcattccgccggagcaacaaccacttccaactgatgaaaat
ggtgtggatcaatcaactgatttacctcttgttgtcgttaaagtaggtcgaaatcttcgt
tttgtaataggatatcttaagtatgatttaaataaaccctatgttttctcacatgccttg
ttagtcggcatattaacggtagcacttctggtcgttgtttttgtaattgtacttataata
ttcagaaggaaatcaacacaagcagaacgcgagtataaacgtattcagatacagatgatt
acattagaaagcaacgtacgttctgagtgtaaacaggcattcgctgagctccaaacggac
atgaccgacctaacagcagatttggagagcacaggcataccaactttagatcacgtcaac
tatattatgaaggtgtttttccctggtgtatcagatcatcctattttaaattctccaaaa
tttcgtgaaggtagcccacagactaactatgacgcagctatggtacaatttgaacaactg
attggcaataaatattttttattaatgttcatagaaacattagaagctcaacgttcatca
ttttctattagagaccgagttaacgttgcctcattaataatggttgttttaatgaacaag
atggaatatgccacggaaattttgaagtcccttttattacgtttgatagataaatcactt
gccagcaaacatcctcagctgatgctaaggcgtactgaaagcgttgttgaaaaaatgttg
accaactacctagcaatttgtatgtacgattacctgaaagagtacgccggatcaaattta
tttttgctcttcaaagcaataaagcatcaaattgaaaagggtttagtggacgcaataacc
aacgatgcccgttactccctttcagaagaacgtcttctgcatgaacaagttacccattct
gttgtaatattgcatattttacaagatgatcttgatgaaaaagtccaatgtcgcgttaac
gattgggataccatttctcaagttaagcttaaaatcctcgacgcaatttttaaaaacact
cctttctctatgaggccatctgtaaacgaagtagacttagaatggaggcacggccgagga
ggtcatcttacattacaagatgaagacttgacaaccaaaaccgttaacggatggaagcgc
cttaacacattagctcattatggagtcaaagaatctgcagtaatgtcactaattgcacgt
caaaatgataattatcatataccatacagtaaaaaccaaaattcggcaccataccacaat
ttttattttataaacaattcgcaaagtcatattataattaataatgatatcgaatcaggt
ttgcagcagccccgggtttaccatcttgttaagcccaatatacctgatcattatatgaac
attaaaaattccgtgttatccggaggatcaccagcatttcaatcgcatgtcgttaataat
tgtaatgacagggtgaacaaaacaataccagaagtttaccttacacgtcttctggccaca
aaaggaactatacaaaaatttgttgatgattttttctcaattattttaactgttaatgag
gagttgccacctgccgttaaatggctctttgacttacttgatgaagctgcgcgacgccat
gatattgctgatactgatattgtgcacgcttggaagtcaaattgtttgccccttcgattc
tgggttaattttataaaaaatccggattttatatttgatgtaaataaaacatacagcgtt
gattcctgtttaagtgtcattgcacaaacatttatggacgcttgttcaacatcagagcac
agacttggaaaagattcgccgtcgaataagttgctgtttgctaaggatattccaaactat
agaattatggtcaaagagttttaccgcgatgtatcaaggcttccacaaataagcgaccag
gaaatgagtacagctatgcaacagctatcagtaaggcaaaacgaagagtttgatactatt
tctgcattaaaagagttatacatttatataactaaatataaggatcagattatggaatca
cttgaaactgatattaattgccgaaagatgcatctttcacgaaaattaggaaatgttgct
gctacactagatggtgattgcacatctaattgctga

DBGET integrated database retrieval system