KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1725
Entry
Dmel_CG1725       CDS       T00030                                 

Gene name
dlg1
Definition
(RefSeq) discs large 1, isoform B
  KO
K12076  disks large protein 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway - fly
    Dmel_CG1725 (dlg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG1725 (dlg1)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    Dmel_CG1725 (dlg1)
SSDB
Motif
Pfam: Guanylate_kin PDZ L27_1 PDZ_6 PDZ_2 SH3_1 SH3_2 SH3_9 TFIIA
Other DBs
NCBI-GeneID: 32083
NCBI-ProteinID: NP_996406
FlyBase: FBgn0001624
UniProt: P31007
Structure
PDB: 
4RP3 4RP4 3TVT 4RP5

Position
X
AA seq 970 aa
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALLDIQEFYELTL
LDDSKSIQQKTAETLQIATKWEKDGQAVKIADFIKSSNLNRNCAYEFNNDASSNQTNQSA
LNQNPIANNVSAQAQAEALSRTFKSELEEILNQRMRIESDTENAKEPTVEQQQKQQQAQQ
RSSRSPQQQNPQQQQGSKSRSGSQTVNGDDSWLYEDIQLERGNSGLGFSIAGGTDNPHIG
TDTSIYITKLISGGAAAADGRLSINDIIVSVNDVSVVDVPHASAVDALKKAGNVVKLHVK
RKRGTATTPAAGSAAGDARDSAASGPKVIEIDLVKGGKGLGFSIAGGIGNQHIPGDNGIY
VTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGKT
QHLTTSASGGGGGGLSSGQQLSQSQSQLATSQSQSQVHQQQHATPMVNSQSTEPGSRYAS
TNVLAAVPPGTPRAVSTEDITREPRTITIQKGPQGLGFNIVGGEDGQGIYVSFILAGGPA
DLGSELKRGDQLLSVNNVNLTHATHEEAAQALKTSGGVVTLLAQYRPEEYNRFEARIQEL
KQQAALGAGGSGTLLRTTQKRSLYVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDD
EWWQARRVLGDNEDEQIGIVPSKRRWERKMRARDRSVKFQGHAAANNNLDKQSTLDRKKK
NFTFSRKFPFMKSRDEKNEDGSDQEPFMLCYTQDDANAEGASEENVLSYEAVQRLSINYT
RPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQ
NHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKS
VDSVMEMNRRMTEEQAKKTYERAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWSQSGP
TIWVPSKESL
NT seq 2913 nt   +upstreamnt  +downstreamnt
atgccagtgaaaaagcaagaagctcatcgggctctcgagctgctcgaggactaccacgcg
agactttcggagccgcaggatcgggcgctgcgtattgcaatcgaacgcgttatacgcata
tttaaatctcgcttgtttcaagcgctgttagatatacaagaattctatgaattgacatta
ttggatgactcgaagagcatacaacaaaagacagcggagaccttgcaaattgcaaccaaa
tgggaaaaggatggccaggcagtcaaaatagctgattttatcaaatcttcaaacctcaat
cgcaattgcgcctatgagtttaacaacgacgcctcatccaatcaaaccaaccaatcagca
ctcaatcagaatccgatcgcgaataatgtgagtgcccaagcgcaggccgaggccctcagc
agaacatttaagagtgaattggaagagatcttgaatcagcgcatgcgcatcgaatcggac
acggaaaatgccaaggagccaactgtcgagcagcagcaaaagcagcagcaagcgcagcag
cgcagttcccgctccccgcagcagcagaatccgcagcagcagcagggatccaaatcgagg
agcgggtcccagactgtgaatggcgatgatagctggttatacgaggacattcagctggag
cgcggcaactccggattgggcttttccattgccggcggtacggataatccgcacatcggc
accgacacctccatctacatcaccaagctcatttccggtggagcagctgccgccgatgga
cgtctgagcatcaacgatatcatcgtatcggtgaacgatgtgtccgtggtggatgtgcca
catgcctccgccgtggatgccctcaagaaggcgggcaatgttgttaagctgcatgtgaag
cgaaaacgtggaacggccaccaccccggcagcgggatcggcggcaggagatgctcgggat
agtgcggccagcggaccgaaggtcatcgaaatcgatctggtcaagggcggcaagggactg
ggcttctcaattgccggcggcattggcaaccagcacatccccggcgacaatggcatctat
gtgaccaagttgatggacggcggagcagcgcaggtggacggacgtctctccatcggagat
aagctgattgcagtgcgcaccaacgggagcgagaagaacctggagaacgtaacgcacgaa
ctggcggtggccacgttgaaatcgatcaccgacaaggtgacgctgatcattggaaagaca
cagcatctgaccaccagtgcgtccggcggcggaggaggaggcctttcatccggacaacaa
ttgtcgcagtcccaatcgcagttggccaccagccagagccaaagtcaggtgcatcagcag
cagcatgcgacgccgatggtcaattcgcagtcgacagagcccgggtcgcgatacgcctct
acaaatgtcctagccgccgttccaccaggaactccacgcgctgtcagcaccgaggatata
accagagaaccgcgcaccatcaccatccagaagggaccgcagggcctgggcttcaatatc
gttggcggcgaggatggccagggtatctatgtgtccttcatcctggccggcggcccagcg
gatctcgggtcggagttgaagcgtggcgaccagctgctcagcgtgaacaatgtcaatctc
acgcacgccacccacgaagaggcagcccaggcgctcaagacttctggcggtgtggtgacc
ctgttggcgcagtaccgcccagaggagtacaatcgcttcgaggcacgcattcaagagttg
aaacaacaggctgccctcggtgccggcggatcgggaacgctgctgcgcaccacgcaaaag
cgatcgctgtatgtgcgcgccctgtttgactacgatccgaatcgggatgatggattgccc
tcgcgaggattgccctttaagcacggcgatatcctgcacgtgaccaatgcctccgacgat
gaatggtggcaggcacgacgagttctcggcgacaacgaggacgagcaaatcggtattgta
ccatcgaaaaggcgttgggagcgcaaaatgcgagctagggaccgcagcgttaagttccag
ggacatgcggcagctaataataatctggataagcaatcgacattggatcgaaagaaaaag
aatttcacattctcgcgcaaatttccgtttatgaagagtcgcgatgagaagaatgaagat
ggcagcgaccaagagccctttatgctttgctacacacaagacgatgccaatgctgaagga
gcttccgaggagaacgtgttgtcctacgaggccgtacagcgtttgtccatcaactacacg
cgcccggtgattattctgggacccctgaaggatcgcatcaacgatgaccttatatcagag
tatcccgacaagttcggctcttgtgtgccacacaccacccgacccaagcgagagtacgag
gtggatggtagggactaccactttgtatcctctcgcgagcaaatggaacgggatattcag
aatcatctgttcatcgaggcgggacagtataacgacaatctgtacggcacatcggtggcc
agcgtgcgcgaagtggccgagaagggtaaacactgcatcctggacgtgtccgggaacgcc
atcaagcgactccaagttgcccagctgtatcccgtcgccgtgttcatcaagcccaagtcg
gtggattcagtgatggaaatgaatcgtcgcatgacggaggagcaggccaagaagacttac
gagcgggcgattaaaatggagcaagaattcggcgaatactttacgggcgttgtccaaggc
gataccatcgaggagatttacagcaaagtgaaatcgatgatttggtcccagtcgggacca
accatttgggtaccttccaaggaatctctatga

DBGET integrated database retrieval system