KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17287Help
Entry
Dmel_CG17287      CDS       T00030                                 

Gene name
CG17287
Definition
(RefSeq) uncharacterized protein
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG17287 (CG17287)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     Dmel_CG17287 (CG17287)
Membrane trafficking [BR:dme04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    Dmel_CG17287 (CG17287)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Spt4
Motif
Other DBs
NCBI-GeneID: 36939
NCBI-ProteinID: NP_611197
FlyBase: FBgn0034202
UniProt: A1ZAR2
Position
2R
AA seq 338 aa AA seqDB search
MCPIGEGHRRVPCCAVRWLPALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLLFFYHLL
LFMFLWTWFRCIFVAPVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTI
DGLVRYCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVY
CFYLFCVMVYDLYLICGFEVTALKNQHSWNILQYLVCILFNIFTVIMYTVSLLNVSRNRT
TMESAYATYFLLGGKNNNGFNLGYFVNFRDLYGDKWYLWPFPIFSSRGDGFSFPLAHDRL
KEVRTGNQKKDNQPTRTQMYKENMNRILGIHQPPFNEE
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtgcccgattggggaaggccatagaagagtgccctgttgcgcggtcagatggcttcct
gctctaataattctgggctttttggtatggtcctaccacgtatttgtttaccaaatctgc
ataaagaaagtttcggactacttgaccattggactgttgctctttttctaccatctactg
ttgttcatgtttctatggacatggtttcggtgcattttcgtagctccagttaggattccc
gatcaatggaaaatatcacccgaggatgtcgacaaattgaagcgaaacgatggaatagag
ggagcatctcgagtcttaaattatgcagctagaaatttacccattgccacgtgcaccatc
gatggactagtgagatattgcaagacttgctggattattaagccggatagagctcatcac
tgtcgaacctgccacatgtgcgtcctgaaaatggaccaccactgtccttggatagtgaac
tgcgtgcactttcacaacttcaagtacttcatactcttcctgttttacgctgaagtatat
tgcttttatctgttctgcgtaatggtctatgatttgtacctgatttgtggctttgaagtt
actgccctgaaaaatcagcattcctggaacattcttcagtacttggtatgcatactcttt
aacatattcaccgtgattatgtacactgtcagcttgttaaacgtatctcgaaatcgcacc
actatggagtcggcttatgccacatactttcttcttggcggcaagaacaataatggtttc
aatttgggatattttgttaattttcgtgacctttatggcgataagtggtacctctggccc
tttccgatcttctctagtcgtggtgacggattttcattccccttggcccacgatcgacta
aaggaagtccgtaccggtaaccagaaaaaagataatcaacccaccagaactcagatgtac
aaggaaaacatgaatcgaattctcggaattcatcagccacctttcaatgaagaatag

DBGET integrated database retrieval system