KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17489Help
Entry
Dmel_CG17489      CDS       T00030                                 

Gene name
RpL5
Definition
(RefSeq) ribosomal protein L5, isoform A
  KO
K02932  large subunit ribosomal protein L5e
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03010  Ribosome
Module
dme_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dmel_CG17489 (RpL5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:dme01009]
    Dmel_CG17489 (RpL5)
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dme03011]
    Dmel_CG17489 (RpL5)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dmel_CG17489 (RpL5)
Ribosome [BR:dme03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    Dmel_CG17489 (RpL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L5e Ribosomal_L18_c THUMP
Motif
Other DBs
NCBI-GeneID: 3355124
NCBI-ProteinID: NP_001036387
FlyBase: FBgn0064225
UniProt: Q9W5R8 R9Q794
Position
2L
AA seq 299 aa AA seqDB search
MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTFQDKNKYNTPKYRLIVRLSNKDI
TVQIAYARIEGDRVVCAAYSHELPKYGIQVGLTNYAAAYCTGLLVARRVLNKLGLDSLYA
GCTEVTGEEFNVEPVDDGPGAFRCFLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRF
PGYSAETKSFNADVHRAHIFGQHVADYMRSLEEEDEESFKRQFSRYIKLGIRADDLEDIY
KKAHQAIRNDPTHKVTAKKSSAVTKKRWNAKKLTNEQRKTKIAAHKAAYVAKLQSETEA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcgttaaggtagtcaagaacaagcagtactttaagaggtaccaagtcaagttc
cgaaggcgtcgcgaaggaaagaccgattactatgccaggaaacgcctaacatttcaggac
aagaacaagtacaacactcccaagtaccgtttgatcgtacgtttgtccaacaaggacatc
acagtacagatcgcctatgctcgcatcgagggtgatcgcgtggtgtgcgctgcttattcc
catgagcttcccaaatacgggatccaggttggattgaccaactacgctgctgcttactgc
acaggcctgctggtcgcccgtcgtgtccttaacaagttgggactggactccctatatgca
ggatgcactgaagtgactggtgaggagttcaacgtcgagcctgttgatgacggcccaggg
gcattccgttgcttcttggatgttggactcgctcgtactacaactggtgcccgtgtgttt
ggcgctatgaagggagcagttgatggtggtctaaacatacctcactctgtgaaacgcttt
cctggatactctgctgaaaccaagagctttaatgccgatgtgcatcgcgctcatatattt
ggccagcacgttgcagactatatgcgttctttggaggaggaggatgaggagagcttcaaa
aggcagtttagccgatacatcaagttgggcattcgtgctgatgatcttgaggatatctat
aaaaaagcccaccaggcaattcgtaacgaccctacacacaaggtcaccgctaagaagtct
tctgccgttacgaagaaaaggtggaatgctaagaaactcacaaacgagcaacggaagact
aagattgcagctcataaggcagcatatgttgccaagctgcagtctgaaactgaggcttaa

DBGET integrated database retrieval system