KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17520Help
Entry
Dmel_CG17520      CDS       T00030                                 

Gene name
CkIIalpha
Definition
(RefSeq) casein kinase IIalpha, isoform D
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03008  Ribosome biogenesis in eukaryotes
dme04137  Mitophagy - animal
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    Dmel_CG17520 (CkIIalpha)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG17520 (CkIIalpha)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    Dmel_CG17520 (CkIIalpha)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG17520 (CkIIalpha)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dme03009]
    Dmel_CG17520 (CkIIalpha)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dmel_CG17520 (CkIIalpha)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: Other
  CK2 family
   Dmel_CG17520 (CkIIalpha)
Ribosome biogenesis [BR:dme03009]
 Eukaryotic type
  90S particles
   Kinase
    Dmel_CG17520 (CkIIalpha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 48448
NCBI-ProteinID: NP_001036624
FlyBase: FBgn0264492
UniProt: P08181 A4V2B8
Position
3L
AA seq 336 aa AA seqDB search
MTLPSAARVYTDVNAHKPDEYWDYENYVVDWGNQDDYQLVRKLGRGKYSEVFEAINITTT
EKCVVKILKPVKKKKIKREIKILENLRGGTNIITLLAVVKDPVSRTPALIFEHVNNTDFK
QLYQTLTDYEIRYYLFELLKALDYCHSMGIMHRDVKPHNVMIDHENRKLRLIDWGLAEFY
HPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQL
VRIAKVLGTEELYAYLDKYNIDLDPRFHDILQRHSRKRWERFVHSDNQHLVSPEALDFLD
KLLRYDHVDRLTAREAMAHPYFLPIVNGQMNPNNQQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacacttcctagtgcggctcgcgtgtacacagatgtcaatgcgcacaaaccggatgaa
tattgggactatgaaaattatgtggttgattggggcaatcaagacgattatcagttggtc
cgtaaattaggccgtggaaagtattctgaggtcttcgaggccattaatattacgaccacg
gaaaagtgcgttgttaaaattctgaaacctgttaaaaaaaagaagataaagcgtgaaatc
aaaattttggagaacttgcgtggaggaactaatataataacacttttagccgttgtcaag
gacccagtttctcgaacaccagcgttgatttttgagcacgtcaacaacacagatttcaag
caactttaccaaacattaactgattatgagattcgttactacttgtttgagcttcttaag
gcacttgactactgccacagcatgggaataatgcatcgtgatgtaaagccccacaatgtt
atgatagatcacgaaaatcgaaaattgcgccttatagattggggacttgccgaattttac
catcctggtcaagaatataatgttcgtgtggcttcgagatactttaaaggtcccgaatta
ctggtagattaccagatgtatgattactcactggatatgtggtcactaggttgtatgttg
gcgtcgatgatattccgaaaagagccatttttccacggacatgataactatgatcaattg
gtacgcattgccaaggtgctgggcaccgaagaactctacgcatatttggataaatacaat
attgacctcgatccaagatttcacgacattctacagcgtcactcacgaaagcgatgggaa
agatttgtccattctgacaaccaacatctagtttctcctgaagcactagactttcttgat
aaacttttacgctatgatcacgttgatcgactcacagctcgcgaagcaatggcccatcca
tatttcttacctattgtcaatggtcaaatgaatcccaataatcagcaataa

DBGET integrated database retrieval system