KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17522
Entry
Dmel_CG17522      CDS       T00030                                 
Symbol
GstE10
Name
(RefSeq) glutathione S transferase E10, isoform B
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00480  Glutathione metabolism
dme00980  Metabolism of xenobiotics by cytochrome P450
dme00982  Drug metabolism - cytochrome P450
dme00983  Drug metabolism - other enzymes
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dmel_CG17522 (GstE10)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG17522 (GstE10)
   00982 Drug metabolism - cytochrome P450
    Dmel_CG17522 (GstE10)
   00983 Drug metabolism - other enzymes
    Dmel_CG17522 (GstE10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG17522 (GstE10)
Enzymes [BR:dme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Dmel_CG17522 (GstE10)
Transporters [BR:dme02000]
 Other transporters
  Pores ion channels [TC:1]
   Dmel_CG17522 (GstE10)
SSDB
Motif
Pfam: GST_N_3 GST_N GST_C_3 GST_C GST_N_2 GST_C_2 GST_N_4
Other DBs
NCBI-GeneID: 37105
NCBI-ProteinID: NP_001286570
FlyBase: FBgn0063499
UniProt: Q4V6J1
Position
2R
AA seq 240 aa
MANLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLED
GESCIWDSHAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALF
KENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDA
TKYPKLSAWLARISALPFYEEDNLRGARLLADKIRSKLPKQFDKLWQKAFEDIKSGAGKQ
NT seq 723 nt   +upstreamnt  +downstreamnt
atggctaacctgattctatatggcactgagtccagtccgccggtccgtgccgttttgttg
acccttcgtgccctccagctggaccatgaattccatacgctggacatgcaggccggcgat
catctgaagccggatatgttacgcaagaatccccagcacacggtacccatgctggaggat
ggtgagtcatgcatttgggactcacacgccatcatcggctatctggtgaacaagtacgcc
cagtcggatgagctctatccaaaggatccgctgaagcgagctgtggtggatcagcggctg
catttcgagaccggtgtcctttttcacggcatcttcaagcaattgcagagagctctgttc
aaagagaatgccactgaggtgcccaaggatcgtttggctgagttgaaggatgcctacgcc
ttgctggagcaatttctggcggagaatccctatgtggccggtcctcagctgaccatcgcc
gattttagcattgtggccaccgtgagcactctgcacctgagctactgtcccgtggatgcg
accaaataccccaaattatccgcctggttggcacgtatctccgcattgcccttctatgag
gaggacaacttgagaggagcccgcttgttggccgataagattcgctccaagctgcccaag
cagtttgacaagctgtggcaaaaggcctttgaggacatcaagagcggagctggaaaacag
tga

DBGET integrated database retrieval system