KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1765Help
Entry
Dmel_CG1765       CDS       T00030                                 

Gene name
EcR
Definition
(RefSeq) ecdysone receptor, isoform G
  KO
K14034  ecdysone receptor
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG1765 (EcR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG1765 (EcR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:dme03310]
    Dmel_CG1765 (EcR)
Transcription factors [BR:dme03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone-like
    Dmel_CG1765 (EcR)
Nuclear receptors [BR:dme03310]
 1. Thyroid hormone like
  1H. Liver X receptor like receptor
   Dmel_CG1765 (EcR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 35540
NCBI-ProteinID: NP_001163061
FlyBase: FBgn0000546
UniProt: P34021 E1JGY2
Structure
PDB: 

Position
2R
AA seq 878 aa AA seqDB search
MKRRWSNNGGFMRLPEESSSEVTSSSNGLVLPSGVNMSPSSLDSHDYCDQDLWLCGNESG
SFGGSNGHGLSQQQQSVITLAMHGCSSTLPAQTTIIPINGNANGNGGSTNGQYVPGATNL
GALANGMLNGGFNGMQQQIQNGHGLINSTTPSTPTTPLHLQQNLGGAGGGGIGGMGILHH
ANGTPNGLIGVVGGGGGVGLGVGGGGVGGLGMQHTPRSDSVNSISSGRDDLSPSSSLNGY
SANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCC
KFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREKKAQKEKDKMTTSP
SSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILAKCQARNIPSLTYNQ
LAVIYKLIWYQDGYEQPSEEDLRRIMSQPDENESQTDVSFRHITEITILTVQLIVEFAKG
LPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYTRDSYKMAGMADN
IEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQSYYIDTLRIYILNR
HCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDVHAIPPSVQ
SHLQITQEENERLERAERMRASVGGAITAGIDCDSASTSAAAAAAQHQPQPQPQPQPSSL
TQNDSQHQTQPQLQPQLPPQLQGQLQPQLQPQLQTQLQPQIQPQPQLLPVSAPVPASVTA
PGSLSAVSTSSEYMGGSAAIGPITPATTSSITAAVTASSTTSAVPMGNGVGVGVGVGGNV
SMYANAQTAMALMGVALHSHQEQLIGGVAVKSEHSTTA
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcgctggtcgaacaacggcggcttcatgcgcctaccggaggagtcgtcctcg
gaggtcacgtcctcctcgaacgggctcgtcctgccctcgggggtgaacatgtcgccctcg
tcgctggactcgcacgactattgcgatcaggacctttggctctgcggcaacgagtccggt
tcgtttggcggctccaacggccatggcctaagtcagcagcagcagagcgtcatcacgctg
gccatgcacgggtgctccagcactctgcccgcgcagacaaccatcattccgatcaacggc
aacgcgaatgggaatggaggctccaccaatggccaatatgtgccgggtgccactaatctg
ggagcgttggccaacgggatgctcaatgggggcttcaatggaatgcagcaacagattcag
aatggccacggcctcatcaactccacaacgccctcaacgccgaccaccccgctccacctt
cagcagaacctggggggcgcgggcggcggcggtatcgggggaatgggtattcttcaccac
gcgaatggcaccccaaatggccttatcggagttgtgggaggcggcggcggagtaggtctt
ggagtaggcggaggcggagtgggaggcctgggaatgcagcacacaccccgaagcgattcg
gtgaattctatatcttcaggtcgcgatgatctctcgccttcgagcagcttgaacggatac
tcggcgaacgaaagctgcgatgcgaagaagagcaagaagggacctgcgccacgggtgcaa
gaggagctgtgcctggtttgcggcgacagggcctccggctaccactacaacgccctcacc
tgtgagggctgcaaggggttctttcgacgcagcgttacgaagagcgccgtctactgctgc
aagttcgggcgcgcctgcgaaatggacatgtacatgaggcgaaagtgtcaggagtgccgc
ctgaaaaagtgcctggccgtgggtatgcggccggaatgcgtcgtcccggagaaccaatgt
gcgatgaagcggcgcgaaaagaaggcccagaaggagaaggacaaaatgaccacttcgccg
agctctcagcatggcggcaatggcagcttggcctctggtggcggccaagactttgttaag
aaggagattcttgaccttatgacatgcgagccgccccagcatgccactattccgctacta
cctgatgaaatattggccaagtgtcaagcgcgcaatataccttccttaacgtacaatcag
ttggccgttatatacaagttaatttggtaccaggatggctatgagcagccatctgaagag
gatctcaggcgtataatgagtcaacccgatgagaacgagagccaaacggacgtcagcttt
cggcatataaccgagataaccatactcacggtccagttgattgttgagtttgctaaaggt
ctaccagcgtttacaaagataccccaggaggaccagatcacgttactaaaggcctgctcg
tcggaggtgatgatgctgcgtatggcacgacgctatgaccacagctcggactcaatattc
ttcgcgaataatagatcatatacgcgggattcttacaaaatggccggaatggctgataac
attgaagacctgctgcatttctgccgccaaatgttctcgatgaaggtggacaacgtcgaa
tacgcgcttctcactgccattgtgatcttctcggaccggccgggcctggagaaggcccaa
ctagtcgaagcgatccagagctactacatcgacacgctacgcatttatatactcaaccgc
cactgcggcgactcaatgagcctcgtcttctacgcaaagctgctctcgatcctcaccgag
ctgcgtacgctgggcaaccagaacgccgagatgtgtttctcactaaagctcaaaaaccgc
aaactgcccaagttcctcgaggagatctgggacgttcatgccatcccgccatcggtccag
tcgcaccttcagattacccaggaggagaacgagcgtctcgagcgggctgagcgtatgcgg
gcatcggttgggggcgccattaccgccggcattgattgcgactctgcctccacttcggcg
gcggcagccgcggcccagcatcagcctcagcctcagccccagccccaaccctcctccctg
acccagaacgattcccagcaccagacacagccgcagctacaacctcagctaccacctcag
ctgcaaggtcaactgcaaccccagctccaaccacagcttcagacgcaactccagccacag
attcaaccacagccacagctccttcccgtctccgctcccgtgcccgcctccgtaaccgca
cctggttccttgtccgcggtcagtacgagcagcgaatacatgggcggaagtgcggccata
ggacccatcacgccggcaaccaccagcagtatcacggctgccgttaccgctagctccacc
acatcagcggtaccgatgggcaacggagttggagtcggtgttggggtgggcggcaacgtc
agcatgtatgcgaacgcccagacggcgatggccttgatgggtgtagccctgcattcgcac
caagagcagcttatcgggggagtggcggttaagtcggagcactcgacgactgcatag

DBGET integrated database retrieval system